Identifiers and Description

Gene Model Identifier

TTHERM_00161100

Standard Name

NRK12 (NIMA-Related Kinase)

Aliases

PreTt28502 | 13.m00461 | 3829.m01323

Description

NIMA-Related Kinase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF01163 ) RIO1 family
  • ( PF00069 ) protein kinase domain
  • ( PF07714 ) protein tyrosine kinase
  • ( PF01517 ) hepatitis delta virus delta antigen

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00161100

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05366.19.997093137033517e-262protein kinase domain-containi
ng protein (1150 aa)
OxytrichaContig1219.1.g1018.997677048217667e-123Protein kinase domain
DictyBaseDDB_G02892779.996162112727537e-67nek4 on chromosome: 5 position
2561379 to 2563106
WormBaseWBGene000226312.0008958828286524e-54locus:nekl-2 status:Confirme
d UniProt:O01775 protein_i
d:CCD64899.1
Stentor CoeruleusSteCoe_328753.817497188671175e-54
SGDYMR001C1.0002335610448659e-38CDC5 Polo-like kinase with mul
tiple functions in mitosis and
cytokinesis through substrate
phosphorylation, also functio
ns in adaptation to DNA damage
during meiosis; has similarit
y to Xenopus Plx1 and S. pombe
Plo1p; possible Cdc28p substr
ate

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16611747: Wloga D, Camba A, Rogowski K, Manning G, Jerka-Dziadosz M, Gaertig J (2006) Members of the NIMA-related kinase family promote disassembly of cilia by multiple mechanisms. Molecular biology of the cell 17(6):2799-810

Sequences

>TTHERM_00161100(coding)
ATGTCTGCTTTAAATGGAAATAATAATTAGCCTCATGACAATGAGCGTTACAAGCAGATA
AAACTGCTTGGAGAGGGTTCTTTTGGAAAAGCATATTTAGTAGAGTGTCAAAGCGATGGA
AGCCTCTGTGTTATCAAAAAAATGGACACAAAAAGCATGACAGAGGCTGAGAAGTAAGAG
ACGGTTCGTGAAGCTCATATTTTAGAAGCTTTGAACCATCCTTGCATTGTAAAGTTTAGA
GAAGTATATAAAACTAAGAAGGCTCTTTGCATTGTGATGGATTTTTGCGATGGTGGAGAT
TTAGCTAAAAAAATTTAAGATTATAAAGGGAAGTTCATACCAGAAAATTAAATATTAGAT
TGGTTTACATAAATATGTTTGGCGTTAAAGCACATCCACGATAGAAAAATTGTGCATAGA
GACTTAAAAACATAAAATATTTTCTTAATGAAAGATAATGCCTTGAAAGTTGGTGATTTT
GGTATTGCTAAAGTTTTAAGACACACTAGAGAAAACTGCAAAACTATGGTGGGAACACCA
TATTATATATCTCCTGAAATATTGGAAGCAAAACCATATTCTTTTCGCTCAGATATATGG
TCACTTGGTGTTATACTTTACGAAATGTGTGCTTAGAAGCCACCTTTTGATGGTATTGGT
TTATCTAACCTTGCCTTAAAAATTGTGAAAGGAGTGTATGCTCCAATTTCTTCTTATTAC
TCAAAAGATATGACCCAGCTTATTTCTCTTTTGTTGAATGTTGATCCTTCTAAAAGACCT
CAAGTTAATCAAATTCTAAAGCTACCCATTATTTAGCACAGAATCAAAAAATTTTTAAGT
GAAACTATACGCTAAAATGAATTTTCTCATACTATTTTGCACAATCGTAACTTCGTAAGC
AACAACTTGAATTTAGATAATATTCCCTCTCCTATGCCTTTTCAGTAGCAAGTAAGACCA
TCAATTCAGCAAAATCAATAAGGTTTGTAATAGCAATAGTAATAATAACAATAATAAATT
TCATAAATTCCTATGTAATAACCTGTGGTTAGATAAAATATGCAGCCTTTAAATAATATG
AATAACAACAATAATAATGGATTAGGTGCTTTTCTTTCTCCTCAAAATAGAAATCCATAA
ATACCTCCTTAAAAGCCATCTCAGTAAATTTTATAACAGCAGTAACCATAAAATATACTT
GGTTACTTACCTTAAAATTAGCAATAAATTTAATAGCAAAATAACTATTAATTGTTCTAA
AATCAAAAGCAGTAGCAACCATAAATATTACAGAATGGAAATAATTTAATGAAAAACAAT
AACAACATAAATAATAATATTAAAAATGAAGTTCCTCTTGCTGCTGTACCAGGTGCATAA
AATGGAAATATAGTTGGATATAAAATAAACAATAACAACTATATATAAAATAACATTAAC
CAGGCTCCAACTCCTGCTTTATATATGAAAATCTAAACAGAATAGCCTCCCCAATCTGTT
TAGTAGCAGTAAATGCCATAATAGTAATAATAGTAGAAACCAGTTCCAAATTAGGTCAAT
AACAATCAGAATGGATAAAACCCAAATCAAAGAGGACCATAGCAACTTTTAAATTAATAG
AAAATTCAATTTTTTGAAAACAACAATGATATTAAGAGATAAAATAACGTAAATGCTCAA
GATTTTATGCCTAATCCTATGGATAAACTTAGAAGAGAAGTATCAGAACCAACTTTTGTT
GGAAAATCAAAGCCTCTTTTTGATAATCTTGAGTAAAAAAAGTAGTAAATGATACAAAGA
GAAAAAGCTCTAGAAAAGAAAATTGAAGAAATAAAGGAAAACAAAAAAGAGTAACAGTAT
AAGAAGATATACGAAAATATAAAAAATGATGATTTATCACCAAATTTAAATAATTACAAT
CCTAATAATTATAAATAGAATAATGTAAATAATATTGCTCCTCAATCTAAACGTGACTCT
TAGAGCACGCCTTCGAATAACTTAGGTAACAGCAAAAAAAATTTAAAGAACCAATTAGCA
TAGCCTTCAGAAGATAAAGAAAAAAGAAAGCAAAAGTATGAAGAGGAAAGAAAAAAAATG
TTTGAAGATATCAAGTAGATAAGACAAAAAAAATTAATGGAATCTCAATCAGAGTAAAAA
TTAGAGTTTTTCATGAATTTAAAACCTCCAAAAGACGATGTTGCAAACAACAACGAAAAC
CTTCTAAAAGGGTAACCAGAAAATGAAATTAAAAAATCAAGTAAAAAATTCAGCTCAAGA
GATATTCCTGTAGAGATTTATGAGTCTAAGAAGTCACCAAATGTAATTCAATAGCAGTAA
TTATAATAATAATAGCAATAGCAGTAACAATAATAAAATTAGTAGCTAAATTTCTTCTAA
AATAATCCTCAATAGTAAAATAATAATGCTAAGTAGAGATATAATTAATAAGATTACAAT
TCTTCACCTACTAAGTAGCAAAATCAATAACAAAAAAACTAGAATCAAAAAGATTAATAG
CAGTAGAATCTTTCTGGGGAACGCCAAAATTCTTAAGGGAGTAAAGATTTAAGTGACGAC
ATTTCCTATATTCCACATACAAATTAAGATATACTTCAAAAACTTTTAGAGTGTGTAGGA
GATGGAGAAGAAGTTAATGATTTTGATTTCAATAGCTCAAATAGCGACAATTCTGATTTA
AGAGAAAAATAAAATAAATTATAAGAAGAGTTAAATAAGTCAGTTAATGAAATTGAGAAA
AAATATGTAAATAATTTAGAAAGAGATGATGATGAAGAAGAAATAGAATCAGATGAAAGT
TCTAAGAACTTAATGCTAAAGTTAAAAGGTATTAGAGAGACAAATGATAATGAGTTTGAT
GATATTAAATCTTCTAGCGATGAAGATGAGAGAGACTATGTAGATAAAGAGTGGGAAGAG
TGCACAAGCAGAGAAGACAGTGATTATGATGAAGAATACTTGAAATCAGAAAAAGATTAC
AATAAAATTAAAAATAAAGTTCAATTAGAGAAAAATTAAGAGGAGAAGAACTATTCCTAA
AAGCAAAAGTAAGCAGAAAATAAGTAAGATATTTAAAAATAAAACGAAGTTACTGAATAT
GATACTAATAGTGGATAAAAAGAAAATATTTCAGGCTGTATCAACAGTGCTGCACCTTCA
ACATAAGCATCATCAAATAGATCAGAGACTCAAACTGAATCTTAGTTAGATTCATTAAAG
TTTATTATTGAAGAGAAGGTAGGGAGATTATCTTTCTAATAATGCATAAAGTAATTAAAA
ACCTATCTTAGCGACCAGAGCAATAGAGGCAGTTAAAAAAGTGAGGAGGATGATTTGGAT
TACTTTTTATTTAACGACTTGAGTAAACTCTTTGTGACAATACCTTAACAAACAGCAAAT
GAATTTGGCCCTCTTATAATTATGTACTATAATATGTCTTAAGACTAATTTGCATGA


>TTHERM_00161100(protein)
MSALNGNNNQPHDNERYKQIKLLGEGSFGKAYLVECQSDGSLCVIKKMDTKSMTEAEKQE
TVREAHILEALNHPCIVKFREVYKTKKALCIVMDFCDGGDLAKKIQDYKGKFIPENQILD
WFTQICLALKHIHDRKIVHRDLKTQNIFLMKDNALKVGDFGIAKVLRHTRENCKTMVGTP
YYISPEILEAKPYSFRSDIWSLGVILYEMCAQKPPFDGIGLSNLALKIVKGVYAPISSYY
SKDMTQLISLLLNVDPSKRPQVNQILKLPIIQHRIKKFLSETIRQNEFSHTILHNRNFVS
NNLNLDNIPSPMPFQQQVRPSIQQNQQGLQQQQQQQQQQISQIPMQQPVVRQNMQPLNNM
NNNNNNGLGAFLSPQNRNPQIPPQKPSQQILQQQQPQNILGYLPQNQQQIQQQNNYQLFQ
NQKQQQPQILQNGNNLMKNNNNINNNIKNEVPLAAVPGAQNGNIVGYKINNNNYIQNNIN
QAPTPALYMKIQTEQPPQSVQQQQMPQQQQQQKPVPNQVNNNQNGQNPNQRGPQQLLNQQ
KIQFFENNNDIKRQNNVNAQDFMPNPMDKLRREVSEPTFVGKSKPLFDNLEQKKQQMIQR
EKALEKKIEEIKENKKEQQYKKIYENIKNDDLSPNLNNYNPNNYKQNNVNNIAPQSKRDS
QSTPSNNLGNSKKNLKNQLAQPSEDKEKRKQKYEEERKKMFEDIKQIRQKKLMESQSEQK
LEFFMNLKPPKDDVANNNENLLKGQPENEIKKSSKKFSSRDIPVEIYESKKSPNVIQQQQ
LQQQQQQQQQQQNQQLNFFQNNPQQQNNNAKQRYNQQDYNSSPTKQQNQQQKNQNQKDQQ
QQNLSGERQNSQGSKDLSDDISYIPHTNQDILQKLLECVGDGEEVNDFDFNSSNSDNSDL
REKQNKLQEELNKSVNEIEKKYVNNLERDDDEEEIESDESSKNLMLKLKGIRETNDNEFD
DIKSSSDEDERDYVDKEWEECTSREDSDYDEEYLKSEKDYNKIKNKVQLEKNQEEKNYSQ
KQKQAENKQDIQKQNEVTEYDTNSGQKENISGCINSAAPSTQASSNRSETQTESQLDSLK
FIIEEKVGRLSFQQCIKQLKTYLSDQSNRGSQKSEEDDLDYFLFNDLSKLFVTIPQQTAN
EFGPLIIMYYNMSQDQFA


>TTHERM_00161100(gene)
ATGTCTGCTTTAAATGGAAATAATAATTAGCCTCATGACAATGAGCGTTACAAGCAGATA
AAACTGCTTGGAGAGGGTTCTTTTGGAAAAGCATATTTAGTAGAGTGTCAAAGCGATGGA
AGCCTCTGTGTTATCAAAAAAATGGACACAAAAAGCATGACAGAGGCTGAGAAGTAAGAG
ACGGTTCGTGAAGCTCATATTTTAGAAGCTTTGAACCATCCTTGCATTGTAAAGTTTAGA
GAAGTATATAAAACTAAGAAGGCTCTTTGCATTGTGATGGATTTTTGCGATGGTGGAGAT
TTAGCTAAAAAAATTTAAGATTATAAAGGGAAGTTCATACCAGAAAATTAAATATTAGAT
TGGTTTACATAAATATGTTTGGCGTTAAAGCACATCCACGATAGAAAAATTGTGCATAGA
GACTTAAAAACATAAAATATTTTCTTAATGAAAGATAATGCCTTGAAAGTTGGTGATTTT
GGTATTGCTAAAGTTTTAAGACACACTAGAGAAAACTGCAAAACTATGGTGGGAACACCA
TATTATATATCTCCTGAAATATTGGAAGCAAAACCATATTCTTTTCGCTCAGATATATGG
TCACTTGGTAAGAATTAAAATTAATTTAAATTAGAGCAGTTTTACAAATTCTATTGCTTG
TTTATTTATTTCCACATAAAAGCACTCACACAAAGTGCTACTTACTTTGATAAAACTTCA
CTTGACTTTAATATTTGAATAATGCTACTGAAACAAATGCTATCTATTTATTTATTACTA
AAAAGTTATTAAATTTTTTTCAAATTAAATTTTCAAATTTTTTGAAATATTTTATAAAAT
GATATGCATGTAAATGTAAAGCTAACTGATTCAGCCATTTTTTTATTAATTTAAATTTAT
TGATATTAATATAAAATAGGTGTTATACTTTACGAAATGTGTGCTTAGAAGCCACCTTTT
GATGGTATTGGTTTATCTAACCTTGCCTTAAAAATTGTGAAAGGAGTGTATGCTCCAATT
TCTTCTTATTACTCAAAAGATATGACCCAGCTTATTTCTCTTTTGTTGAATGTTGATCCT
TCTAAAAGACCTCAAGTTAATCAAATTCTAAAGCTACCCATTATTTAGCACAGAATCAAA
AAATTTTTAAGTGAAACTATACGCTAAAATGAATTTTCTCATACTATTTTGCACAATCGT
AACTTCGTAAGCAACAACTTGAATTTAGATAATATTCCCTCTCCTATGCCTTTTCAGTAG
CAAGTAAGACCATCAATTCAGCAAAATCAATAAGGTTTGTAATAGCAATAGTAATAATAA
CAATAATAAATTTCATAAATTCCTATGTAATAACCTGTGGTTAGATAAAATATGCAGCCT
TTAAATAATATGAATAACAACAATAATAATGGATTAGGTGCTTTTCTTTCTCCTCAAAAT
AGAAATCCATAAATACCTCCTTAAAAGCCATCTCAGTAAATTTTATAACAGCAGTAACCA
TAAAATATACTTGGTTACTTACCTTAAAATTAGCAATAAATTTAATAGCAAAATAACTAT
TAATTGTTCTAAAATCAAAAGCAGTAGCAACCATAAATATTACAGAATGGAAATAATTTA
ATGAAAAACAATAACAACATAAATAATAATATTAAAAATGAAGTTCCTCTTGCTGCTGTA
CCAGGTGCATAAAATGGAAATATAGTTGGATATAAAATAAACAATAACAACTATATATAA
AATAACATTAACCAGGCTCCAACTCCTGCTTTATATATGAAAATCTAAACAGAATAGCCT
CCCCAATCTGTTTAGTAGCAGTAAATGCCATAATAGTAATAATAGTAGAAACCAGTTCCA
AATTAGGTCAATAACAATCAGAATGGATAAAACCCAAATCAAAGAGGACCATAGCAACTT
TTAAATTAATAGAAAATTCAATTTTTTGAAAACAACAATGATATTAAGAGATAAAATAAC
GTAAATGCTCAAGATTTTATGCCTAATCCTATGGATAAACTTAGAAGAGAAGTATCAGAA
CCAACTTTTGTTGGAAAATCAAAGCCTCTTTTTGATAATCTTGAGTAAAAAAAGTAGTAA
ATGATACAAAGAGAAAAAGCTCTAGAAAAGAAAATTGAAGAAATAAAGGAAAACAAAAAA
GAGTAACAGTATAAGAAGATATACGAAAATATAAAAAATGATGATTTATCACCAAATTTA
AATAATTACAATCCTAATAATTATAAATAGAATAATGTAAATAATATTGCTCCTCAATCT
AAACGTGACTCTTAGAGCACGCCTTCGAATAACTTAGGTAACAGCAAAAAAAATTTAAAG
AACCAATTAGCATAGCCTTCAGAAGATAAAGAAAAAAGAAAGCAAAAGTATGAAGAGGAA
AGAAAAAAAATGTTTGAAGATATCAAGTAGATAAGACAAAAAAAATTAATGGAATCTCAA
TCAGAGTAAAAATTAGAGTTTTTCATGAATTTAAAACCTCCAAAAGACGATGTTGCAAAC
AACAACGAAAACCTTCTAAAAGGGTAACCAGAAAATGAAATTAAAAAATCAAGTAAAAAA
TTCAGCTCAAGAGATATTCCTGTAGAGATTTATGAGTCTAAGAAGTCACCAAATGTAATT
CAATAGCAGTAATTATAATAATAATAGCAATAGCAGTAACAATAATAAAATTAGTAGCTA
AATTTCTTCTAAAATAATCCTCAATAGTAAAATAATAATGCTAAGTAGAGATATAATTAA
TAAGATTACAATTCTTCACCTACTAAGTAGCAAAATCAATAACAAAAAAACTAGAATCAA
AAAGATTAATAGCAGTAGAATCTTTCTGGGGAACGCCAAAATTCTTAAGGGAGTAAAGAT
TTAAGTGACGACATTTCCTATATTCCACATACAAATTAAGATATACTTCAAAAACTTTTA
GAGTGTGTAGGAGATGGAGAAGAAGTTAATGATTTTGATTTCAATAGCTCAAATAGCGAC
AATTCTGATTTAAGAGAAAAATAAAATAAATTATAAGAAGAGTTAAATAAGTCAGTTAAT
GAAATTGAGAAAAAATATGTAAATAATTTAGAAAGAGATGATGATGAAGAAGAAATAGAA
TCAGATGAAAGTTCTAAGAACTTAATGCTAAAGTTAAAAGGTATTAGAGAGACAAATGAT
AATGAGTTTGATGATATTAAATCTTCTAGCGATGAAGATGAGAGAGACTATGTAGATAAA
GAGTGGGAAGAGTGCACAAGCAGAGAAGACAGTGATTATGATGAAGAATACTTGAAATCA
GAAAAAGATTACAATAAAATTAAAAATAAAGTTCAATTAGAGAAAAATTAAGAGGAGAAG
AACTATTCCTAAAAGCAAAAGTAAGCAGAAAATAAGTAAGATATTTAAAAATAAAACGAA
GTTACTGAATATGATACTAATAGTGGATAAAAAGAAAATATTTCAGGCTGTATCAACAGT
GCTGCACCTTCAACATAAGCATCATCAAATAGATCAGAGACTCAAACTGAATCTTAGTTA
GATTCATTAAAGTTTATTATTGAAGAGAAGGTAGGGAGATTATCTTTCTAATAATGCATA
AAGTAATTAAAAACCTATCTTAGCGACCAGAGCAATAGAGGCAGTTAAAAAAGTGAGGAG
GATGATTTGGATTACTTTTTATTTAACGACTTGAGTAAACTCTTTGTGACAATACCTTAA
CAAACAGCAAATGAATTTGGCCCTCTTATAATTATGTACTATAATATGTCTTAAGACTAA
TTTGCATGA