Identifiers and Description

Gene Model Identifier

TTHERM_00329960

Standard Name

NPC3 (Nephrocystin-3 ortholog)

Aliases

PreTt30301 | 33.m00313 | 3705.m00139

Description

TPR Domain containing protein; E3 ubiquitin ligase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

  • ( PF00628 ) PHD-finger
  • ( PF01535 ) PPR repeat
  • ( PF08238 ) Sel1 repeat
  • ( TIGR00181 ) oligoendopeptidase F
  • ( PF00515 ) tetratricopeptide repeat
  • ( PF07719 ) tetratricopeptide repeat
  • ( PF07720 ) Tetratricopeptide repeat
  • ( PF07721 ) Tetratricopeptide repeat
  • ( PF08946 ) Osmosensory transporter coiled coil
  • ( PF06696 ) Streptococcal surface antigen repeat
  • ( PF08908 ) Domain of unknown function (DUF1852)
  • ( TIGR00073 ) hydrogenase accessory protein HypB
  • ( PF00097 ) zinc finger, C3HC4 type (RING
  • ( PF08385 ) Dynein heavy chain, N-terminal region
  • ( PF08393 ) Dynein heavy chain, N-terminal region
  • ( TIGR02521 ) type IV pilus biogenesis/stability protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.9%

TetraMine Data

TTHERM_00329960

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_08525.19.997093137033517e-262TPR Domain containing protein
(1227 aa)
Stentor CoeruleusSteCoe_44116.47023492564546e-26
DictyBaseDDB_G02927141.0004572433669413e-23DDB_G0292714 on chromosome: 6
position 1780390 to 1784905
WormBaseWBGene000022151.000361553249356e-16locus:klc-2 Kinesin light ch
ain status:Confirmed UniPr
ot:P46822 protein_id:CCD6511
2.1
OxytrichaContig13558.0.g110.00000000000003999587784428659Tetratricopeptide repeat
SGDYOL013C0.000009999254677478949HRD1 Ubiquitin-protein ligase
required for endoplasmic retic
ulum-associated degradation (E
RAD) of misfolded proteins; ge
netically linked to the unfold
ed protein response (UPR); reg
ulated through association wit
h Hrd3p; contains an H2 ring f
inger

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00329960(coding)
ATGAGCAACGATAAAATTCTACTTCCTATCTTCTCTAGAGCAAAGACATAGTTTTAAGAA
AAATAAATAGATTAAGAATTTAGTATTTGCAATAAACAAATCAATGAAAATCTCTCACCA
CAAATAACTAAAATATATAAAACAAATAACGAAATAAAAAGCCTTCTTGACTAAGGAAAC
TTACAATTATCTTTCAAATTAGCAAAAAAGTAGTATGAATCTAAAAAGAATAATCGAAAT
TCTTCAAATAAGACATTTATTGAATCTCAAATAACTTACGCTGATGTTCTATTTTAATTA
GGTGACTTCAAAGCTTCCTTAGGTCTCTTACTTGACTCTATTGATTGCATATCAAAAAAT
TTAGAAGAACTAGAATAAGAATACAGCAAGGCTTTGGACATGGCAGGAAAAGCCTATCTA
AAGCTAGGCTATTTGAAGAAGGCTGAAGAGTATTTCTTAAAGTCTCTGAATTTTAAGAAA
GAACTTTTCGATTAGGCTAAATCATTTTATTTATTGAGCGTATTATATGAAGAATTAGGC
CAGTATAATTAAGCGATGACAAATTGTGAAAAGAGCTTAAAACTATATATGTCTGTTAAT
TTACATTAGAGTTTAATGTATGCTGAGTGTCTAGACTCAAAAGCTAACTTGTTAAGATCT
CTAGGAAAACTTGAAGAGTCTTTGACATTTTTCAGAGAAGCTTTAGAAATAAAGACAAAG
ATTTTAGGTAAAATAAATCATCCTTAAATAATTTCTTCATAAGAAAATATTGCACTGGTA
CAGAATGAATTAGGAAAATTCTAAGAATCTTATAGCCTTATTTAGGAAGTAGTTAAAAAT
AGAGAGTCATTATATACCTCAGATATATGCCCAAATAGTCACCCTCAGATAGCAGATGCT
TACTAAAATTTAGGCACAATTTAATAGGATTTAGGAATGCTTAAAAAGAGCTTAAATAAT
TAAAAAAAGGCTTTGAGTTTAAGAGAATCTATTTATTAGTATGACCGCTAAATTTAATCC
TAAAATTTCCTTTAGAAAATATTCAATACTGTTAATAGCAATTTGATTAAACTATAATTT
TCTGAAAGTACAACAGAAATTCTTAGTTAAATTTCTACTTAAAATCATCCTGATATTGCT
TCCTCTTACACCTCTTTAGGAATTGTTTATAGGAATATAGGGCATTATGAAGAAGCATAA
GAATATTTACAAAAAGCTTTGAAACAGAGAGAGCTAACTTATGGATATGAGCACACAAAG
GTAAATCAGAAGAGTCCCTTCAACACAACCTAAAATCTTAACAAATTCGCTAAAAAATAT
TTGGTGAAAATGAAAATATCTTATCAGCTCTTTCTATCACCTATTTAGCCTGGTCATATT
ACAATTTATTTGAATATGATTAATCTATTGAACTCAATTAACAAGCGCTAAAAATTTGAA
AACTTAGCTTTGGCGTAGTATAACAGAGAAAATTATGAAGAATCTTTCAAAAATTACCAA
AAAGCCCACGACATAAAAGTAAAAATATACTCAAATGATCATATTTTTATTCCTTCAGCC
AAAAATAACATAGCAGTGGCTTTATATAAGCAGGGAAAGACAGAACAAAGCAAGTTCTTC
TTAAACTAATCTCTATAAATAATATCTAATTTTGAAAATGATGATAAAAATAATAAAGAT
GTAGATCCCTACCTTTTATGCTCAACATTAAACCATTTAGCTTGGGCTCTAACTGAGATG
GAGTAACCTGAAAAAGCTTTATAATACTACAAAAAAACTGAGTAAAAAATGAAATAGCTA
GTAGGAAAAGACCACCTTAATATTTCTAACCTCTATTGTAACATTGGTATTACTTACTTC
CACCTAGGAGATTTTGAAAAGGCTTTGAAATACCATGAATAAGCGTATAGTATAAACATT
TAAGTTTTAGAACCTCATCATTCAATTATTTGCAATAATCTTGACAATATTGGATCATGT
TATAGTAAATAGTAAAAGCACACCAAAGCGCTTGAATATCACATGAAATCCCTATAAATA
AGAAAACAGAAAAGTAAAACTATGAAGGAAGACATTGCTAATTCATATGATCACGTTGCA
AGTACATACTATGACCTTCAAAAATACAAAGAAGCTTTAGAGTATTATTTGCAGGAATTA
AAAATTCGCAAACAATTAAATCAAAAAGGAATTTAGCTGGCTTCTCTTCTTAATAATATA
GCAATAACTTACAAAAATCTAGAAAACCTAGACCGCTCCTTGAAGTACCATTAAAAAACT
TTACGCTTGAGAGAAAGTTATTTGCCTTTTGAACACCAAGAGATTCTTAGTAGTATTTCT
AACATTGCCAGTATCTTATATGACCAAGAAAAATACACTGAAGCTATAGAATTCTACAAA
AAGGAACTTCTATTAAAAGAAAAACTGCATACACCTCAATGTGCTAAAGTTGCTGTAACT
TTGAATAATATTGGATGTTCTTACAAGAATATAAATAACCTTGATGAAGCTGTCAATTAT
CACAGGAAAGCTCTTGAGCTTAGGAAAAAAATTCTAAAAGAAAATGACGATGATATTATC
AGCTCAATAGAGAGCATTTCATCTACTCTTTATGATATGCAAAGATTTTAAGAAGGTCTT
GAATCATATTATGAAGAACTTTAGCTTAAAATAAAGAAATTTGGAGAAGATAATTTGAAA
GTTGCAACAACTTATAATAATATTGCGTGCACTCTTAAAAATTTAGGTCAAATTGCTGAG
GCATTAAAAATGCATCAAAAATCCTTAGTTATAAAGTAAAAAATTTTAGGTCATGATCAC
TTAGATGTAGCAACCTCATTAGATAATATTGCATCAATTATTTATGACCAGAATGACTTT
TAATACGCACTAGAGATGTATAAAAAAGTTTTAGGTATAAGGAGAAAATGCTACTAAACA
AATAATCTATAAATAGCTGTAACACTCCATAATTTAGCTTGCACCTACCATAATTTGAAA
GATTACGAGTCTGCTTTACAGCTACAAATAGAGGTCCTAGAAATGAGAAAATAAATTTAA
GGCCCAGAATCAAAAGACATAATAACTTCTTTAGACAATATTGCATCGAATTTATATGAT
AGTGGCAAATATGAGCAAGCTATTGTTTATTACCAAGATGAACTAGCTTTGATGAGAAAA
GTTGAACCTGAAAACCAAGCTAGAGCAGCTACAACACTAAATAATATTGCATGTACTTTG
CATAACCTGAAGAGATTAAGTGAATCTTTTGAATATCATAATTAAGCATTAAAGATCCGT
AGAGAAAATTTAGGAGAAACTCATCCTGAAACAGTTTCGTCTTTAAATAATATAGCTTCT
AATTTATTTAATGTAGGCAAGCTAGATGAAGCTCTTAATACATTTCTACGTGTGCTTTAA
ATTCGTATTCAATAATAAGAGTGTAAAATAAAAATAGCAACAGCCTATGATAATGTTGGT
TCCACTTATTTCTCTCTCCTCGAATTTGAGAAAGCTCTTGAGCATTTTGAGTAATCTTAT
GAAATAAGAAGAACTTATAATTTGGATGATTTATAGAACTCTCAAGATATGATAAATGCA
GCACGCTAAATGATACAAAAAATAGAACCAATCAGGAATCTTCCAATAACAAAATATACA
GGAAAAAACTCATAAGAAAATAATGATAAAAATAATCAAGAAAGTATTGTAAAAGGAGAA
GACGAAGAGGAAATATGCAATATATGTCTTGAAAATCTTAACAATAACTAAGAATTGCGT
GTACTTCCTTGTAGCCACTTTTATCATACGTTCTGCATAGACAAATGGTTACTTGCTAAA
TAATCTTGTCCTAATTGCAGGTAGTGTCCTATTGTAAATTATTAACAAGATAACTAAGAT
AAAATCGAATGA


>TTHERM_00329960(protein)
MSNDKILLPIFSRAKTQFQEKQIDQEFSICNKQINENLSPQITKIYKTNNEIKSLLDQGN
LQLSFKLAKKQYESKKNNRNSSNKTFIESQITYADVLFQLGDFKASLGLLLDSIDCISKN
LEELEQEYSKALDMAGKAYLKLGYLKKAEEYFLKSLNFKKELFDQAKSFYLLSVLYEELG
QYNQAMTNCEKSLKLYMSVNLHQSLMYAECLDSKANLLRSLGKLEESLTFFREALEIKTK
ILGKINHPQIISSQENIALVQNELGKFQESYSLIQEVVKNRESLYTSDICPNSHPQIADA
YQNLGTIQQDLGMLKKSLNNQKKALSLRESIYQYDRQIQSQNFLQKIFNTVNSNLIKLQF
SESTTEILSQISTQNHPDIASSYTSLGIVYRNIGHYEEAQEYLQKALKQRELTYGYEHTK
VNQKSPFNTTQNLNKFAKKYLVKMKISYQLFLSPIQPGHITIYLNMINLLNSINKRQKFE
NLALAQYNRENYEESFKNYQKAHDIKVKIYSNDHIFIPSAKNNIAVALYKQGKTEQSKFF
LNQSLQIISNFENDDKNNKDVDPYLLCSTLNHLAWALTEMEQPEKALQYYKKTEQKMKQL
VGKDHLNISNLYCNIGITYFHLGDFEKALKYHEQAYSINIQVLEPHHSIICNNLDNIGSC
YSKQQKHTKALEYHMKSLQIRKQKSKTMKEDIANSYDHVASTYYDLQKYKEALEYYLQEL
KIRKQLNQKGIQLASLLNNIAITYKNLENLDRSLKYHQKTLRLRESYLPFEHQEILSSIS
NIASILYDQEKYTEAIEFYKKELLLKEKLHTPQCAKVAVTLNNIGCSYKNINNLDEAVNY
HRKALELRKKILKENDDDIISSIESISSTLYDMQRFQEGLESYYEELQLKIKKFGEDNLK
VATTYNNIACTLKNLGQIAEALKMHQKSLVIKQKILGHDHLDVATSLDNIASIIYDQNDF
QYALEMYKKVLGIRRKCYQTNNLQIAVTLHNLACTYHNLKDYESALQLQIEVLEMRKQIQ
GPESKDIITSLDNIASNLYDSGKYEQAIVYYQDELALMRKVEPENQARAATTLNNIACTL
HNLKRLSESFEYHNQALKIRRENLGETHPETVSSLNNIASNLFNVGKLDEALNTFLRVLQ
IRIQQQECKIKIATAYDNVGSTYFSLLEFEKALEHFEQSYEIRRTYNLDDLQNSQDMINA
ARQMIQKIEPIRNLPITKYTGKNSQENNDKNNQESIVKGEDEEEICNICLENLNNNQELR
VLPCSHFYHTFCIDKWLLAKQSCPNCRQCPIVNYQQDNQDKIE


>TTHERM_00329960(gene)
ATGAGCAACGATAAAATTCTACTTCCTATCTTCTCTAGAGCAAAGACATAGTTTTAAGAA
AAATAAATAGATTAAGAATTTAGTATTTGCAATAAACAAATCAATGAAAATCTCTCACCA
CAAATAACTAAAATATATAAAACAAATAACGAAATAAAAAGCCTTCTTGACTAAGGAAAC
TTACAATTATCTTTCAAATTAGCAAAAAAGTAGTATGAATCTAAAAAGAATAATCGAAAT
TCTTCAAATAAGACATTTATTGAATCTCAAATAACTTACGCTGATGTTCTATTTTAATTA
GGTGACTTCAAAGCTTCCTTAGGTCTCTTACTTGACTCTATTGATTGCATATCAAAAAAT
TTAGAAGAACTAGAATAAGAATACAGCAAGGCTTTGGACATGGCAGGTATTTATTTATTG
ATTTATTTGTTTTTTTACTTAGAGTTTTACCAAAAAAAGAATTGAAACATATTTAAAAAA
GCTGTTTTTCCAAAATGTTCTACTTGAAAAAAAAAAAATAATAATTCTAAAATATATTAA
TAGTTTTATTTATTTATTAATAGGAAAAGCCTATCTAAAGCTAGGCTATTTGAAGAAGGC
TGAAGAGTATTTCTTAAAGTCTCTGAATTTTAAGAAAGAACTTTTCGATTAGGCTAAATC
ATTTTATTTATTGAGCGTATTATATGAAGAATTAGGCCAGTATAATTAAGCGATGACAAA
TTGTGAAAAGAGCTTAAAACTATATATGTCTGTTAATTTACATTAGAGTTTAATGTATGC
TGAGTGTCTAGACTCAAAAGCTAACTTGTTAAGATCTCTAGGAAAACTTGAAGAGTCTTT
GACATTTTTCAGAGAAGCTTTAGAAATAAAGACAAAGATTTTAGGTAAAATAAATCATCC
TTAAATAATTTCTTCATAAGAAAATATTGCACTGGTACAGAATGAATTAGGAAAATTCTA
AGAATCTTATAGCCTTATTTAGGAAGTAGTTAAAAATAGAGAGTCATTATATACCTCAGA
TATATGCCCAAATAGTCACCCTCAGATAGCAGATGCTTACTAAAATTTAGGTATATTTAT
TTAATTTTCATTAAAATTCGCATTTCTATTTTATGATTAAAAAATATAAATTAAAATTAG
TTTTAACTTTATTTTCTATATAACAAATATTTAAGCATTCATTCTATTTGTTTATTGTAC
AATTTTTAAAAGCAAAAAAGATTTCATTAAATATATTTTATTAAGAATCAAATAACTCTA
TAAATTGTAGTTTCTATCTAAAAATAATCTAATTAATTTATCATCTCATAAAAAAAAACT
TTATTAAAAGTACTTATTTATTATAAAGGAAAGGCATTTAAACAAATAAGTATAATGCAA
TTCCTTTTTTTATCATATAAAAACAATATTAATTTCTTTAAAGAGATTTACTTTCACTAG
AAAATTTTAATTTCACAAAAAACATTTGATTTACAAAATATTTATTTGAATACTTGACAC
AAAAAATTATATATATCAATAGGCACAATTTAATAGGATTTAGGAATGCTTAAAAAGAGC
TTAAATAATTAAAAAAAGGCTTTGAGTTTAAGAGAATCTATTTATTAGTATGACCGCTAA
ATTTAATCCTAAAATTTCCTTTAGAAAATATTCAATACTGTTAATAGCAATTTGATTAAA
CTATAATTTTCTGAAAGTACAACAGAAATTCTTAGTTAAATTTCTACTTAAAATCATCCT
GATATTGCTTCCTCTTACACCTCTTTAGGAATTGTTTATAGGAATATAGGGCATTATGAA
GAAGCATAAGAATATTTACAAAAAGCTTTGAAACAGAGAGAGCTAACTTATGGATATGAG
CACACAAAGTACGCAATTACACTAAATTACCTCGCCTGAACCCTTGACGAATAGGGTAAA
TCAGAAGAGTCCCTTCAACACAACCTAAAATCTTAACAAATTCGCTAAAAAATATTTGGT
GAAAATGAAAATATCTTATCAGCTCTTTCTATCACCTATTTAGCCTGGTCATATTACAAT
TTATTTGAATATGATTAATCTATTGAACTCAATTAACAAGCGCTAAAAATTTGGTAAAGA
AATATTAAGAGTCACCCTTATATTACTTCTACTTTAGAAAACTTAGCTTTGGCGTAGTAT
AACAGAGAAAATTATGAAGAATCTTTCAAAAATTACCAAAAAGCCCACGACATAAAAGTA
AAAATATACTCAAATGATCATATTTTTATTCCTTCAGCCAAAAATAACATAGCAGTGGCT
TTATATAAGCAGGGAAAGACAGAACAAAGCAAGTTCTTCTTAAACTAATCTCTATAAATA
ATATCTAATTTTGAAAATGATGATAAAAGTAAATATTTATTAAAATTTGATTATAATTAT
TTTTTTAATTTTTGTTATATTTTCTAAATAATTAATTATGCTAAAAAACGCTTTATAATT
TCTAAAAATTTTCAAACAAAATATATCAAAAAATAAAAATAAATTTACAAAAAAAAAAAA
TGAATTTTGAAATATTTTTGTAATACTTAATAATATAAATTGAATAACCTTAATTACTTA
TAGATGGTATTAGTTTAATAAAAAAATATTTTAAAACATTAACTCAATAAAAAACTAGCA
AATTTTTTATTTGTTTTATCATTCTTTTAATTTTAATTATAAATTATTGTAAACATTTTA
TTAATAATTTTTTTATATAAGATAATAAAGATGTAGATCCCTACCTTTTATGCTCAACAT
TAAACCATTTAGCTTGGGCTCTAACTGAGATGGAGTAACCTGAAAAAGCTTTATAATACT
ACAAAAAAACTGAGTAAAAAATGAAATAGCTAGTAGGAAAAGACCACCTTAATATTTCTA
ACCTCTATTGTAACATTGGTATTACTTACTTCCACCTAGGAGATTTTGAAAAGGCTTTGA
AATACCATGAATAAGCGTATAGTATAAACATTTAAGTTTTAGAACCTCATCATTCAATTA
TTTGCAATAATCTTGACAATATTGGATCATGTTATAGTAAATAGTAAAAGCACACCAAAG
CGCTTGAATATCACATGAAATCCCTATAAATAAGAAAACAGAAAAGTAGTACTGAATTTA
AGATTTTATTTTAACTTAATGAATTTAAATATTAACATCAGTAATTTAAAAAAAATTTAA
ATATATAGGTAAAACTATGAAGGAAGACATTGCTAATTCATATGATCACGTTGCAAGTAC
ATACTATGACCTTCAAAAATACAAAGAAGCTTTAGAGTATTATTTGCAGGAATTAAAAAT
TCGCAAACAATTAAATCAAAAAGGAATTTAGCTGGCTTCTCTTCTTAATAATATAGCAAT
AACTTACAAAAATCTAGAAAACCTAGACCGCTCCTTGAAGTACCATTAAAAAACTTTACG
CTTGAGAGAAAGTTATTTGCCTTTTGAACACCAAGAGATTCTTAGTAGTATTTCTAACAT
TGCCAGTATCTTATATGACCAAGAAAAATACACTGAAGCTATAGAATTCTACAAAAAGGA
ACTTCTATTAAAAGAAAAACTGCATACACCTCAATGTGCTAAAGTATATTTACTTTTAAT
TATAATTTATTAAATATATATGTGGTTGTGAATATTTATACTATTTGTAAAGATTTTTTT
AAATAAAATTTTGATTGAAATTTTAAACGATTATAAATAGGTTGCTGTAACTTTGAATAA
TATTGGATGTTCTTACAAGAATATAAATAACCTTGATGAAGCTGTCAATTATCACAGGAA
AGCTCTTGAGCTTAGGAAAAAAATTCTAAAAGAAAATGACGATGATATTATCAGCTCAAT
AGAGAGCATTTCATCTACTCTTTATGATATGCAAAGATTTTAAGAAGGTCTTGAATCATA
TTATGAAGAACTTTAGCTTAAAATAAAGAGTAATTTTTGATCTATATAATTTCCATCAAT
TTAAAATTTTTTTGAAATATAGAATTTGGAGAAGATAATTTGAAAGTTGCAACAACTTAT
AATAATATTGCGTGCACTCTTAAAAATTTAGGTCAAATTGCTGAGGCATTAAAAATGCAT
CAAAAATCCTTAGTTATAAAGTAAAAAATTTTAGGTCATGATCACTTAGATGTAGCAACC
TCATTAGATAATATTGCATCAATTATTTATGACCAGAATGACTTTTAATACGCACTAGAG
ATGTATAAAAAAGTTTTAGGTATAAGGAGAAAATGCTACTAAACAAATAATCTATAAATA
GCTGTAACACTCCATAATTTAGCTTGCACCTACCATAATTTGAAAGATTACGAGTCTGCT
TTACAGCTACAAATAGAGGTAAACAAAAAATTATTTTAATCTAATGATTTTTCATTTAAA
AATCCTTGAATCATTTTTTTTCAACTTTTTTTTTAAATTAGGTCCTAGAAATGAGAAAAT
AAATTTAAGGCCCAGAATCAAAAGACATAATAACTTCTTTAGACAATATTGCATCGAATT
TATATGATAGTGGCAAATATGAGCAAGCTATTGTTTATTACCAAGATGAACTAGCTTTGA
TGAGAAAAGTTGAACCTGAAAACCAAGCTAGAGCAGCTACAACACTAAATAATATTGCAT
GTACTTTGCATAACCTGAAGAGATTAAGTGAATCTTTTGAATATCATAATTAAGCATTAA
AGATCCGTAGAGAAAATTTAGGAGAAACTCATCCTGAAACAGTTTCGTCTTTAAATAATA
TAGCTTCTAATTTATTTAATGTAGGCAAGCTAGATGAAGCTCTTAATACATTTCTACGTG
TGCTTTAAATTCGTATTCAATAATAAGAGTGTAAAATAAAAATAGCAACAGCCTATGATA
ATGTTGGTTCCACTTATTTCTCTCTCCTCGAATTTGAGAAAGCTCTTGAGCATTTTGAGT
AATCTTATGAAATAAGAAGAACTTATAATTTGGATGATTTATAGAACTCTCAAGATATGA
TAAATGCAGCACGCTAAATGATACAAAAAATAGAACCAATCAGGAATCTTCCAATAACAA
AATATACAGGAAAAAACTCATAAGAAAATAATGATAAAAATAATCAAGAAAGTATTGTAA
AAGGAGAAGACGAAGAGGAAATATGCAATATATGTCTTGAAAATCTTAACAATAACTAAG
AATTGCGTGTACTTCCTTGTAGCCACTTTTATCATACGTTCTGCATAGACAAATGGTTAC
TTGCTAAATAATCTTGTCCTAATTGCAGGTAGTGTCCTATTGTAAATTATTAACAAGATA
ACTAAGATAAAATCGAATGA