Identifiers and Description

Gene Model Identifier

TTHERM_00161070

Standard Name

NOT2 (NOT2/NOT3/NOT5 family protein, subunit of the CCR4-NOT complex)

Aliases

PreTt28499 | 13.m00458 | 3829.m01320

Description

NOT2 / NOT3 / NOT5 family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00161070

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05364.19.997093137033517e-262NOT2/NOT3/NOT5 family protein
(402 aa)
DictyBaseDDB_G02720565.998312950603665e-35DDB_G0272056 on chromosome: 2
position 1115108 to 1118319
WormBaseWBGene000038269.998720540547892e-23locus:ntl-3 status:Confirmed
UniProt:Q0PDJ7 protein_id
:CAB07318.1
OxytrichaContig21723.0.g242.0004286606204839e-16NOT2 / NOT3 / NOT5 family
Stentor CoeruleusSteCoe_253270.000000000000001713908431542013
SGDYPR072W0.000000000010004361180063202NOT5 Subunit of the CCR4-NOT c
omplex, which is a global tran
scriptional regulator with rol
es in transcription initiation
and elongation and in mRNA de
gradation

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00161070(coding)
ATGTCTAAAAAAAGAACTCCTGAAGAGGTTGAAGAAGCAGCTAAAAATGTCCTTAAATTA
TGCGAAAGTGTAGAAAATTAAATAAAAAGTCTTAAACAAGATTAGCACTCAAATGATTAA
AGAGATTCAATAGTTAAGGCAATAAGCAGAGATTTGAGCAATCTGAAAAGCATAAGGAAA
AATTAGCTTACTGATGTCGTTTTAAAATAGCACGGCTCATTCTAATTCTAATTCAATAAA
GAAGCAATCTACACTCTTTAGAATATTGTTAACCACGCTGACAATGTGATTAGAAAAGTA
GAATAGAATTTCCCAAATGCACAAAAGGACGAATTCTTATAATGGTATTAAGATTTCAGA
GAAATAATGAATCATAGAATAAAGGAACTTAAGCAAAAGCAACAATAACCAAATAACAAG
AAGGTCAAAAAACCATTAAACTAGAAGCAAAACGACAAAAATGATCAGCTTATTGAAGCC
ATTGAATTCCATCAACAAAAGCTAGATGAAATAAAAATGTTCTTGGAATCTCATATAAAC
ATTTCCATTCCTATCGACTCGTTAACAGCTGTCAAATAAGCTCTTAAAGATATTTTCAAT
TCTGACAGTTAAGATGAGCTCATTAACAATGAAAATATAAAATTCCATTATGATACTATT
GAGAGTGTTTATGAAAGTGATTCAACTTCAACAACTAAATAAGAAGTCCCTTAAACTGCT
GGCACTAACAGTTCATTTACTCTTTTCAATAAAAGCAAGTTATTAGCGTCTTAATAAGAA
AGAAAAAAAGACTTTTCATACTTGACAAACATGCTCCAAACAAGCTTTAACAACTCAATT
CAATAGTCAGATTTCTATCCTTCTGAATTGACCAAAGTCAGTACATCAAATAAAAGCTTG
TTTCCAAAGTATAAAATGCTTTCAGAGGATGTCTTTAGCAAATTTGATCTAGAAACTCTT
TTCTTTATTTTCTACTTTTAGAAAAATACTTATGAACAATACAATGCAGCTAAAACTCTT
AAAAATAAGAGCTGGAGATATCACAAGAAGTATATGACTTGGTTCCAAAGATTAGAAGCT
CCAAAAATTTAAGAAGAAGAATATGAACAGGGAACATATGTAATTTTTGATTATGAAAAG
GGCTGGATCTAGAGAAAGAAAGTAGACTTTAATTTCAAATATACATATTTGGAAGATGAA
TTAAAAGTCTGA


>TTHERM_00161070(protein)
MSKKRTPEEVEEAAKNVLKLCESVENQIKSLKQDQHSNDQRDSIVKAISRDLSNLKSIRK
NQLTDVVLKQHGSFQFQFNKEAIYTLQNIVNHADNVIRKVEQNFPNAQKDEFLQWYQDFR
EIMNHRIKELKQKQQQPNNKKVKKPLNQKQNDKNDQLIEAIEFHQQKLDEIKMFLESHIN
ISIPIDSLTAVKQALKDIFNSDSQDELINNENIKFHYDTIESVYESDSTSTTKQEVPQTA
GTNSSFTLFNKSKLLASQQERKKDFSYLTNMLQTSFNNSIQQSDFYPSELTKVSTSNKSL
FPKYKMLSEDVFSKFDLETLFFIFYFQKNTYEQYNAAKTLKNKSWRYHKKYMTWFQRLEA
PKIQEEEYEQGTYVIFDYEKGWIQRKKVDFNFKYTYLEDELKV


>TTHERM_00161070(gene)
ATGTCTAAAAAAAGAACTCCTGAAGAGGTTGAAGAAGCAGCTAAAAATGTCCTTAAAGTA
ATTAGCTATTTTATAAAATTGATTATGTTTCATTTAATTAAAATTTTCAAATTTTTCAAT
CATAATAGTTATGCGAAAGTGTAGAAAATTAAATAAAAAGTCTTAAACAAGATTAGCACT
CAAATGATTAAAGAGATTCAATAGTTAAGGCAATAAGCAGAGATTTGAGCAATCTGAAAA
GGTAAAAATTCAATTCTAAATTAGAATTAATTTATATCTAATTGCTAATATTTAAATAAA
GTTCTATATATTATTCAAATATTACTTAAAAGCATAAGGAAAAATTAGCTTACTGATGTC
GTTTTAAAATAGCACGGCTCATTCTAATTCTAATTCAATAAAGAAGCAATCTACACTCTT
TAGAATATTGTTAACCACGCTGACAATGTAATAAACATTTTTTGTTTTATCTAGTATTAT
TTACATTATTGAAAAGCAACAAATCCAATTTAATTTTATGAAAAGGTGATTAGAAAAGTA
GAATAGAATTTCCCAAATGCACAAAAGGACGAATTCTTATAATGGTAAAATAATTAATGA
AAGAAGAGGTTTATTCAAACTAAAATTGTAATTAGGTATTAAGATTTCAGAGAAATAATG
AATCATAGAATAAAGGAACTTAAGCAAAAGCAACAATAACCAAATAACAAGAAGGTAATT
AATATTTTTATAAAATAAGTAAATTTATTGTATCGTTTAAATAAAAAGGTCAAAAAACCA
TTAAACTAGAAGCAAAACGACAAAAATGATCAGCTTATTGAAGCCATTGAATTCCATCAA
CAAAAGCTAGATGAAATAAAAATGTTCTTGGAATCTCATATAAACATTTCCATTCCTGTA
TTTACAAATTAAAAAATAAGCACTTTACTATCTTTTTAATTATTAAATAGATCGACTCGT
TAACAGCTGTCAAATAAGCTCTTAAAGATATTTTCAATTCTGACAGTTAAGATGAGCTCA
TTAACAATGAAAATATAAAATTCGTAAATATAATTACTATTGCTAAAAATTGAAATAAAT
TACTTTTAACTATTTAATAAAGCATTATGATACTATTGAGAGTGTTTATGAAAGTGATTC
AACTTCAACAACTAAATAAGAAGTCCCTTAAACTGCTGGCACTAACAGTTCATTTACTCT
TTTCAATAAAAGCAAGTTATTAGCGTCTTAATAAGAAAGAAAAAAAGACTTTTCATACTT
GACAAACATGCTCCAAACAAGCTTTAACAACTCAATTCAATAGTCAGATTTCTATCCTTC
TGAATTGACCAAAGTCAGTACATCAAATAAAAGCTTGTTTCCAAAGTATAAAATGCTTTC
AGAGGATGTCTTTAGCAAATTTGATCTAGAAACTCTTTTCTTTATTTTCTACTTTTAGAA
AGTAAGTTTGATTAGAAAATTTATGAAAATAAAATTTTAATGTATTAATAATTTAATAAG
AATACTTATGAACAATACAATGCAGCTAAAACTCTTAAAAATAAGAGCTGGAGATATCAC
AAGAAGTATATGACTTGGTTCCAAAGATTAGAAGCTCCAAAAGTAAAATAAATTTACATT
TAATAAAGAAAAAGATATTAAAACAGAATTATATTTATTCAGATATTGACAAAAAGAAAT
AATAATTTTTAAAAAACAAAAGATTTAAGAAGAAGAATATGAACAGGGAACATATGTAAT
TTTTGATTATGAAAAGGGCTGGATCTAGAGAAAGAAAGTAGACTTTAATTTCAAATATAC
ATATTTGGAAGATGAATTAAAAGTCTGA