Identifiers and Description

Gene Model Identifier

TTHERM_00095500

Standard Name

NOT1 (CCR4-Not complex component, Not1)

Aliases

PreTt22849 | 7.m00298

Description

CCR4-Not complex component, Not1 family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00095500

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_00255.19.997093137033517e-262CCR4-Not complex component, No
t1 family protein (2467 aa)
OxytrichaContig14324.0.g261.0003926095686843e-81CCR4-Not complex component, No
t1
DictyBaseDDB_G02760292.9987037581344066e-55DDB_G0276029 on chromosome: 2
position 6435703 to 6443825
WormBaseWBGene000028459.996696112986116e-50locus:let-711 status:Confirm
ed UniProt:Q20937 protein_
id:CCD70321.2
SGDYCR093W1.9991939848149086e-44CDC39 Component of the CCR4-NO
T complex, which has multiple
roles in regulating mRNA level
s including regulation of tran
scription and destabilizing mR
NAs by deadenylation; basal tr
anscription factor
Stentor CoeruleusSteCoe_142857.281290178321643e-33

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00095500(coding)
ATGAAGAAAGAACTGGGTTAGAGCCAAGCTAACCAGTTCCTCAACAGAAGCGGAAATTCC
AATCAGCAATAGGGTTAAGGAAACGTTGCATCTCCCAACCTTCCTTAATTCATATAGATT
AAGAATTGGGTTGCTTAGCTCAATAACAAGAAGATTCTTAGAGCATAGAGGAACGACATT
ATGAATATAGTACAATAACTAGGATCAGAAGGAAATTAGTATTTGTTGGAATGCCTTTTA
GAAAGTTTGGATATGAACTCACAGAATTCCCAAAATAAGGCAAATTTGCACACCACAGTT
AAAGGCTAATTTTTGAGCCAACATTTGCATGATTTAATATTCAGCAATAGCTTCTCAAAT
TTTCTTGATTTCATGCCCAACGTCTTCATTAAAGTAGTTTGTGGACCTAATAGTTTTTCA
AATTAAACCAATACAAAGCAGCTAAATTAAGTGGTAAATTATGCTTAAGAACTGAGCAAG
TGCCTCAAAATGAATCCTGTTGATTAGCTTTTCATAGCCTTAAGCTTTGCATGTTGCAAC
AACGAAACAGTAGCATCAGAAGGTGTTAAGCTTCTCAGAGAAAAAATTATTGATTTTGTT
TAGTAGCAAAATTAAATTGCTTTGCCTCAAAATAACCTTCCAATTATTTTATTACAATTT
GTTTTGCAAAACCCTGAATTAAAGAATATGTCCCAAGAGATTCTTCAATTAAAGCAAATA
CTCAATGATCCTAAAAATAAAGAAATCAAACCATTAATTTATGGTAGAGATAATATCGAT
GATGAAGGTAACAGCTAAGAAAGTGATGAAATATAAGACCCTGATTTACATAAAGAAATA
AACTATCCTAAGCCAGAAGAGTTAAACCACATAATAGGACCAGCTGACATTCTTAAAGAT
TTAGGCCCAAGTGCACTATCTTCGATGGATAACTTAGTTAGAAGTTTATCATAATTTTAA
AAATGGAGCAATTCTGATGTTTACCTCTCTCTCGAATTGATAGCATAAGACCCTGTTTAA
TTAGGTGATGAATAAACTCAGCGTTTAGCTAACAATATTCTCCAAGTTGAATCCAAAAAC
AGTTAACAAGAATGGGGTAATTTCACTAATTAAGATTAATCAGATAAAAACTAATAAAGC
GATTGGAATGCTGAGTTATTTATTGAATTCCTAATGAAGAAGATATTCCCTCAAAACAAT
GAATTAAATTGGGTTTCCGTATTGACAGAAATTGATAGACCTTATTTGAAATTGAAGGAC
GAAAAATCTTTTAAATAATTCTTTACTAATATGCTATTAATTCACAAAAAAGCTCCATTT
TAAATGCCTGCATATTTGTTACTCAAGCCTTGGAAGAATATTAGAAGCCAAGCCTTATTC
TTAAAGAATATGCTAGCTGTTGGTTCTTCTGAATTAGTAAGATGGAACGAAATTTAAAAA
AATCCTATGAATTTAGAATTCAATCCATAATATAAATATAACACACTACCTTCTCCTATG
CAGTTCTGGGCCTGCTTGGATTTCCTCGATTTATTGTGTGAAATTAGTGAAGGAGATAAC
TATATGGCTATCCATGAGTTATTTGAGCTTCCTATTGCAAAATATCCAGATATCTTAATA
GTCGCTTTATCTTAACTGCATCCTAAAAAAGGTGCAAATCTCTTAGATGAAGTATTCAGT
CAACTATTTCCTAATTATTTGTCGAATCACATAAATTCTGTAGCTATTTTAGAAGCAATT
TGGAAGAATAGAGAGGATTTGCTTATTTCTGCTATTAGCGAACTTTATAGAAAAGAAAAC
AAGAAAGAAAACACATCTTTGAATTTATCAAGAGTCCTTGATATTTCCTAATATCTAAAA
GACTCTTTAATTGCTCTCACAAATAGTAACAACTACTCTTTTTCTGTATCACTTGGTATT
TTAGCTGGTAAGAGAGAATTCCTACACTTTGACTAATGGCTAAATGAGCGTGTTAAGACT
ATTGGGGATCCATTTGTAAATGCTCTACTAGCATATATCGAAGACAATGTTATTAATCCA
ATTAAAGAAATAAATATGAGACTAAACAACCCCAACAATTAAGCTTAACAGTAATATGAA
GGTGTTTTAGAAAAGGCCTAACTAACTATTGAACTACTGACTATTATTTTTGAATCTCTT
CTATTAGAGTAACACCCTGAAAAACTTACTAGCAAAAATCGTTAAAAGTTGTAAGATCAA
TATAAAGAAATATTGTAATATTTCCCCTAATTAAGTGGAACTTCGGATTCACCAGGACAA
GCTACAGAAAAAAAAGCCAATTACAATTACCAAAGATTTTATATGAGAGAAATAACAATA
GAGGAAATGATTGCAAATTTAAAATAATTAATGAATTCCAACAACTCTGAAGACAAAGAA
GTGTTTGCATGCATGATCACAAGCTTGATTGAAGAAGCTAAATACCACTAGTAATACCCC
ATAGCTGAGCTTCTTTTAACAGGCTAACTCCAAGGAAGCATCATAAATGCACAACTTGTC
AACTAGAAACCATTAGGCATTATGCTAGAATAAATTTTGGAATCATCAAAAAAGACACAG
AGATAAGTTGAGTAATCAGTAAAAGCAATAGAAGCTATGAAAGATCGCCTTCATGAATTC
CCTTACTTTGTAAATGCTCTTTTCGACCCATCCTGCCATCTTTCTGAGCAATTTCCTCAA
CTTCTAATTAATATTTATAATATTATGATTGAGAAGAAGGTATAAATTAATGTAACTAGT
AAGCAAATTGAATAGCTTAAATAAAGAGTAGAATCCCTTAAAAATGAAGCAAACAAACCA
TCTCAAACTTACTAGGCAACAACAACTTAACAAAAGAAGATCTTAAAGTTAAGAGGAGAA
GTAGAAACTTCATCTGAAAATACCTCCTAACAACAATAAAATCAACAAGCATAGAACTAA
GCTGCTGCTGTAGCTCAATCTGATTAATCATCAGCACAGCCATAAGCATAAAATTAATAA
TAGTAATAACCATTATAGCAATAGGAAGGAAGTGCTTAGACAAAATAACAACAAGAATAA
GATACTAAAGCAAAAGCTGATTAGAATAACTAGCCTAGAAATCCTAGTGTTTAAAATGTA
AGCTAATAAAATTTAGGTGAAGAAAAATAACCTTCTGATAACACCACACAAAGTAAAGGT
AAAACTAAAAAGCCTCTTTTTGCTGGATCTTCCGTATTTCCTTTGAGCAATTTAACTGCA
AACTAACCAAAAATGGTATTCGAAAATCCTATTAATCAATAGATGAGATTCTAAGATACT
TAAATAGGAATGTATGACCAAGGATTGTATAATAATAATAATAATAGCACTAATAATAAC
AATAATGGCAATAATACAGAAGAGATAGTTGTAAAAGCAAGACCTTACTAAGGAGGTGTT
GGTTTTGTTTAAAGACCTATATTTACAAACGGTGAACAATAAATCTATGCTTCTAAATCT
ATTAATGAAATTTTAGAATATGAAAACTCACTTTAAATAGATGAATCAACAAAGATGAGA
GTTAATTTTGCACTAAATAATTTATCAGATGGAAACATAGAGAAACACTAAAATGATTTT
AGAAATTACGCAGAAAATGAAAATTTTTAGAAATGGTTTGCTAGGCATCTTGTCACTCAA
AGAGCTACTTTGAAATCAGAAATTAATGTCTTGCTGTACACTAAGCTCTGTGAAAGAATA
GATAAGCCTAAACTCTTTTCCTTTATCATAAAAGATTCTTTGTTACTTTTGCACAAACTT
CTCTTATCAGAAGCTGCCATTCATGCTTCTATCCGTATTACCACTCTTAAAAATCTAGCT
CATTGGATAGGCATGTTTACTTTGAATCGTAACAAACCAATCAATTCAAAATATTTGAAT
ATCAAGGCATTAATTGTCAATTCTTATCCGAACAAAGTTGATGTAATTATTCCTATTGTT
ATCAACATTCTACTTTGCTGTAAAGAATCAAAGATTTTTAATCCTTAAACTAACCGCTGG
GTCAAGCGTATTCTTTCTCTCTTAGAAGAATTCAAAAATGTGGTTCAGAAGGAAACTGTC
AAGCATCAAATTAATCAGTTGTTCTCTAATTTATAAATTGACGTAAATAGTTTAGAACCT
TGTACCTACTTTAGATACTACTTACAAGAAAGTAAAAAGGAAGCTAAGCCAGCTTAATAG
CCTGCTACTATTGTTTCTTTTTGCATCCGTGATAGACTAATAATTACAGATGATCTTCGC
AACCTGTGCAATATTTAAAACTTTGACTTAAAGTAAGCAGTTTTCCAATCCTTAGACGAA
GCAATCATGGAAATTATACAACCAGTAATTTCTCGTAGTGTTACTATTGCCTTAGTCACC
ACTCGTGAATTAGTCTTAAAAGATCACTGCACTGATCCTGATGAGAACAATCTTATAAAT
GGCATCTCTAACATGGTTTAAAAACTATCTGGCTGTCTTGCTTTAATCACCTGCAAAGAT
CCACTCAGATCAAGCTTCCAAACCCACTTAAAGACTAATTTAGAAAAAGTGACTGAATTA
AATGCCAACGAAAAGGAATAAATCATTAATAAGGTAGTTATCGATAACATTGATATTGGC
TGCCAAGAAATCCGCTAAAGAGTAATGGATTAAGCTCTTAAGGAAATAAAATAAGATGAT
GCTATCCTTGAAGCTATTGAAATGAGAAGAGCCGCAAAAGAAAAGTAGTAAGTATTTGTT
GATGAAAGATATTACAAGTTCACCAAAAACCTTCCTCCTGCTTTACAACCTAAATTCCCC
AGCTCTTCTGCAGCATACTCAGAATTCGATAGAACTTCTTTAAATGAAAACTTGGTAAGC
GAATACAACACATAAACTTTAGAATAATTCAAAAAGATTGTCAACAATTTTAGTCCAGAA
CAACCTGAAAATGTAATTCTTACTCCTATTGAAGGATTCTTTAAGAAGATCATGTTCTCT
GATAAGCTATATAACGAATTAATTGAATTAAATTTCTAATTGATGTACCAAAGCGAGGGT
GCTTCTAAGATTAGATTATTTGTTGAAATTCTTGACAAATTACGTGAACAGCACAAAGGA
AAAGACAAAATTGGCAAATTATTAAAAGATAATTTAATGAACAGTGCTCCTCTAGACAAT
CTGATTAAGACCAACCTTCATATAATTTTGAATAGCCTTTTCATAAAAAGAATAATAACT
AATAAAGAATATCAAGAAATTATGTTGCTTCTTGTTTCTAGAAATCAAAGCAATGATATG
ATAATATGTTTGGTATCTGCCTTGAGAGAGCTTATTTTTGAGAAAAAGGAATACACTCCT
TAAGATTTTAATGACTCAATTATTGCTCTTAAGTTAACAATGTCTAGTAAATAAGACATT
CCTCCTCATTACTCCTAGTTCTTGCAAGACCTCAACAAAATTGCATCTGAAAACTCTAAT
TAATCAAATAACATTATCACCTTTGAGCGTGCTCTTGATGTTATTACCAACTTCTATGGC
AATTTCGATAAAAAGCAGTATGAAGAAATATAGGAGAAGGTTGAAAAATGGCTTTCTTTG
TCAACTGAAGTTCAAATGGGCTAATTCATTTAAGGCCTTGTTAATATTATCATTGATAAT
CATGATGAAAACTCTTTAAAATTCTTTGTCTACTTTGCTGATATCTGCATCAACTACTCC
TTAGAAAGCGCTAAAAAGAATTAAAGAATTAGCATACAAAATATTACTAGTATGGACTTT
ACTTGCGTTGATAGTTTCACAAAATTGATTGAAATTATTCAAAAGACTTGCAAAATTGAA
CAATATAAGAAGCAATTACTTAATCAAATTTTCGATAGTATATTCATCACATTGACTAAA
TATCATGAAACTGATATGTATGAATTCAACCAGCGTCCATTCTTCCGTATCTTCTTTAAT
TTAATTTATGACAACCAAAGACCTAAATACGATTTCTCTAAGAATGAAATATCTGAAACT
TACAGCATGTTGGCTAACATATTCCATCAACTTTCCCCTGTAAAATACCCAGGATTTGCT
TTCTCTTGGTTAGAACTCATTTCAAATCGTTACTTCATGCCAGTGATTATGGAAAAGGAA
GAATTGTGGGGATTATACAGCCAACTCATAATAGATTTAATCAAATTCTTTAAAGAAATA
ATGCAAGAAGAAAACCTTCAATTAGAATACATTAAGATATTCTACAGAGGCACCATTCGT
ATTTTACTTGTCTTGCTTCATGACTGGCCTGATTTCTTAGCAAAATACTCTAATTCTTTA
TGTGATGAAATTCCTGAAAATTACATTTAAATTAGAAACATTATTCTCGCTGCTTTCCCT
AAAACTATGAAGCCACCTGATCCGTTCTCAAACAAAAACGAACAAATCTTTGAAAACAAT
GAAGACTTTAAGAATCCTCCTATTATGGACTACCCAGTTTATAATGAAAAAATCCAAGTC
GATCTCATGAATGATCTTCAGAATTATCTTCGCACTAAGAGCGAAGATATTTTCAAGACT
ATTTGCTCTAAATTGACTCTTAAAGAAAAATCATAATTTGTAATTGATTAGAAGGCTGTT
AACATACTCATTTTGGCTATACCTTTGCATTTACACAAGCAATCTGTAAATTAAGGAAAT
AAGGATACTAAAACAATCCCTCTAAACAACGATTTATACAATTTCTTACTTAAATTGCTT
AAAACAAGTCATTACGAAATGAGAGAAGTAATTCTTAACTTGATAATAAATCAAGTTAGA
TATCCTAACTTTATCACAAAGTTCTACATTAAATACATTCTGTTGACATTCTAAGAACAA
AATATTAATGATATTTAAGAACAAACCATTCGTATCATTGTAGAGAGATTGTTTGTATAG
AAACCTCACCCTTGGGGCATAATCTACACATTTATTGAGATCATTAAGTCTAATTCTAAT
TTCAGATCAAAGCCTTTTGTCAGAGATGCTGAATTGAAATAAGTTTTCCGCTTCATCTAC
TAAGAACCACCCAGATAAAGACCACCTCAATAATAGTAATAGCAACCATCATAACAACAG
ATTGGTCAGCACATACAACCTCAAGAGATGAACATAGATCAGTAAATGCACATGAATAGT
ATTTAGTACTAGCAGATATTGTAATAGCAACAATAGTAACAATACTAGCAACAATAGCAA
TATCAATAACAAATAGCAGGAGCTATAAGCCATCCTAACTATGTTAATAGAAATAATTGA


>TTHERM_00095500(protein)
MKKELGQSQANQFLNRSGNSNQQQGQGNVASPNLPQFIQIKNWVAQLNNKKILRAQRNDI
MNIVQQLGSEGNQYLLECLLESLDMNSQNSQNKANLHTTVKGQFLSQHLHDLIFSNSFSN
FLDFMPNVFIKVVCGPNSFSNQTNTKQLNQVVNYAQELSKCLKMNPVDQLFIALSFACCN
NETVASEGVKLLREKIIDFVQQQNQIALPQNNLPIILLQFVLQNPELKNMSQEILQLKQI
LNDPKNKEIKPLIYGRDNIDDEGNSQESDEIQDPDLHKEINYPKPEELNHIIGPADILKD
LGPSALSSMDNLVRSLSQFQKWSNSDVYLSLELIAQDPVQLGDEQTQRLANNILQVESKN
SQQEWGNFTNQDQSDKNQQSDWNAELFIEFLMKKIFPQNNELNWVSVLTEIDRPYLKLKD
EKSFKQFFTNMLLIHKKAPFQMPAYLLLKPWKNIRSQALFLKNMLAVGSSELVRWNEIQK
NPMNLEFNPQYKYNTLPSPMQFWACLDFLDLLCEISEGDNYMAIHELFELPIAKYPDILI
VALSQLHPKKGANLLDEVFSQLFPNYLSNHINSVAILEAIWKNREDLLISAISELYRKEN
KKENTSLNLSRVLDISQYLKDSLIALTNSNNYSFSVSLGILAGKREFLHFDQWLNERVKT
IGDPFVNALLAYIEDNVINPIKEINMRLNNPNNQAQQQYEGVLEKAQLTIELLTIIFESL
LLEQHPEKLTSKNRQKLQDQYKEILQYFPQLSGTSDSPGQATEKKANYNYQRFYMREITI
EEMIANLKQLMNSNNSEDKEVFACMITSLIEEAKYHQQYPIAELLLTGQLQGSIINAQLV
NQKPLGIMLEQILESSKKTQRQVEQSVKAIEAMKDRLHEFPYFVNALFDPSCHLSEQFPQ
LLINIYNIMIEKKVQINVTSKQIEQLKQRVESLKNEANKPSQTYQATTTQQKKILKLRGE
VETSSENTSQQQQNQQAQNQAAAVAQSDQSSAQPQAQNQQQQQPLQQQEGSAQTKQQQEQ
DTKAKADQNNQPRNPSVQNVSQQNLGEEKQPSDNTTQSKGKTKKPLFAGSSVFPLSNLTA
NQPKMVFENPINQQMRFQDTQIGMYDQGLYNNNNNSTNNNNNGNNTEEIVVKARPYQGGV
GFVQRPIFTNGEQQIYASKSINEILEYENSLQIDESTKMRVNFALNNLSDGNIEKHQNDF
RNYAENENFQKWFARHLVTQRATLKSEINVLLYTKLCERIDKPKLFSFIIKDSLLLLHKL
LLSEAAIHASIRITTLKNLAHWIGMFTLNRNKPINSKYLNIKALIVNSYPNKVDVIIPIV
INILLCCKESKIFNPQTNRWVKRILSLLEEFKNVVQKETVKHQINQLFSNLQIDVNSLEP
CTYFRYYLQESKKEAKPAQQPATIVSFCIRDRLIITDDLRNLCNIQNFDLKQAVFQSLDE
AIMEIIQPVISRSVTIALVTTRELVLKDHCTDPDENNLINGISNMVQKLSGCLALITCKD
PLRSSFQTHLKTNLEKVTELNANEKEQIINKVVIDNIDIGCQEIRQRVMDQALKEIKQDD
AILEAIEMRRAAKEKQQVFVDERYYKFTKNLPPALQPKFPSSSAAYSEFDRTSLNENLVS
EYNTQTLEQFKKIVNNFSPEQPENVILTPIEGFFKKIMFSDKLYNELIELNFQLMYQSEG
ASKIRLFVEILDKLREQHKGKDKIGKLLKDNLMNSAPLDNLIKTNLHIILNSLFIKRIIT
NKEYQEIMLLLVSRNQSNDMIICLVSALRELIFEKKEYTPQDFNDSIIALKLTMSSKQDI
PPHYSQFLQDLNKIASENSNQSNNIITFERALDVITNFYGNFDKKQYEEIQEKVEKWLSL
STEVQMGQFIQGLVNIIIDNHDENSLKFFVYFADICINYSLESAKKNQRISIQNITSMDF
TCVDSFTKLIEIIQKTCKIEQYKKQLLNQIFDSIFITLTKYHETDMYEFNQRPFFRIFFN
LIYDNQRPKYDFSKNEISETYSMLANIFHQLSPVKYPGFAFSWLELISNRYFMPVIMEKE
ELWGLYSQLIIDLIKFFKEIMQEENLQLEYIKIFYRGTIRILLVLLHDWPDFLAKYSNSL
CDEIPENYIQIRNIILAAFPKTMKPPDPFSNKNEQIFENNEDFKNPPIMDYPVYNEKIQV
DLMNDLQNYLRTKSEDIFKTICSKLTLKEKSQFVIDQKAVNILILAIPLHLHKQSVNQGN
KDTKTIPLNNDLYNFLLKLLKTSHYEMREVILNLIINQVRYPNFITKFYIKYILLTFQEQ
NINDIQEQTIRIIVERLFVQKPHPWGIIYTFIEIIKSNSNFRSKPFVRDAELKQVFRFIY
QEPPRQRPPQQQQQQPSQQQIGQHIQPQEMNIDQQMHMNSIQYQQILQQQQQQQYQQQQQ
YQQQIAGAISHPNYVNRNN


>TTHERM_00095500(gene)
ATGAAGAAAGAACTGGGTTAGAGCCAAGCTAACCAGTTCCTCAACAGAAGCGGAAATTCC
AATCAGCAATAGGGTTAAGGAAACGTTGCATCTCCCAACCTTCCTTAATTCATATAGATT
AAGAATTGGGTTGCTTAGCTCAATAACAAGAAGATTCTTAGAGCATAGAGGAACGACATT
ATGAATGTAATACATCTATCAATCTATCTATCTATTTTCATTTATTTTAGTAAGCATCGA
CTTCAAGTTGTAGCTAGCTCATATTGATTTCGCACTTGCTTTTATCATCCATCCATCATT
GCTATTCATAATTTCTTTCATGCTCCCTGTTCTTCTACTTAGGACTAAAGATTTTCAGTC
AGTCTATCTTCCCATTTATCCTTCCTTCTTTTTAGGTTTTTGGAAGTAGAAAATACACTG
ACTTTAAATATAACTCAAAAAATATATTTATATATCTTAGCTACTATTCTTATCTTTATA
GATATTATAAAGTCTTTTTCGGATCATTGTTTTCTCTTTAAAGATTAATCAATAAGTGAA
TTGATCATTCATTCATTCAATCCAATTTCTCCTTTCTTAAGCAATATTTATAACAAAGCA
ATAAAGCAAAAAAGCAAAAGTGCAAGCAACTACAGCTAATAGGAAAGAATGATTACTAAA
TGATAAAGCAATCGATGTTTTGATAGCAGTGGATAAAATATGTTAGCTACTCAAGCAGCG
GAAGCTCGATGCAATAAAATACATCATAATTAATTTTGTTTGTTTGTAAATTCATAGATA
GTACAATAACTAGGATCAGAAGGAAATTAGTATTTGTTGGAATGCCTTTTAGAAAGTTTG
GATATGAACTCACAGAATTCCCAAAATAAGGCAAATTTGCACACCACAGTTAAAGGCTAA
TTTTTGAGCCAACATTTGCATGATTTAATATTCAGCAATAGCTTCTCAAATTTTCTTGAT
TTCATGCCCAACGTCTTCATTAAAGTAGTTTGTGGACCTAATAGTTTTTCAAATTAAACC
AATACAAAGCAGCTAAATTAAGTGGTAAATTATGCTTAAGAACTGAGCAAGTGCCTCAAA
ATGAATCCTGTTGATTAGCTTTTCATAGCCTTAAGCTTTGCATGTTGCAACAACGAAACA
GTAGCATCAGAAGGTAATTTTTTTACATGCGTTTTCAAACTTGATAAATCCTAAATTTAT
TTTGAAGCCCATTTTCTAGTGATTAATTAGCATTAGATTAAGTATTTAAATAAAAAAAAA
GAGTGAAAAAAGTTAAGAATCTAATCAAAAAGCAAAAGAAAAAGCATGCAAACATCTGCC
GTTTTCAGCAAATAATAAAATGCTAATAAATCAAATGAATTTAAATATAAAATATATTTT
TTCAAGTCAAAATATAAAAATGTAAATAGAGAGCATCTAAATAAAAGGCAATTATTTATT
TATTTAGTGATCTCAAACTTTAAAAAAGATAGGAAAATATTAATTAATTGATTTATTAAG
CGCATTTTTTATTTAATTATTTTTTATGATTATTATCATAATTGGTTGATCTATTAAATC
ATTGAAAAAAATATTAAATGTTCTAAAGGATTAATTCCTTTAGCTATTCATTTATTTATT
AAAACCTGTTCATTTTATTTCAATACTACCATTTTTTAAATGACCATGTAAATAAAAATA
CAAGCAATAAAGTCAATCAATCAATAAATCAAAAAACAAAATATAACTAACTCATTTCAA
ATTTATTTTGCTTCTTCCTCATTATTTTCATTTATTTTAAAATTCTCTTCATTAATTATT
TAGACTAAATAAAATTCACTATAACCCAATTTATTATTAAAAATACATAAAGATTTTTAT
TTTCACTTGGATTTTTATTTTGTTAGTTTCATTCAAATAATTCATTTTATTTTAAATATT
AAAATTTAGGATATTTAAAATTAATTTCTATTTTACTTTTTATAAAAAAAAATGATTAAT
TAATTTTTTTTATTGTTTAAAGGTGTTAAGCTTCTCAGAGAAAAAATTATTGATTTTGTT
TAGTAGCAAAATTAAATTGCTTTGCCTCAAAATAACCTTCCAATTATTTTATTACAATTT
GTTTTGCAAAACCCTGAATTAAAGGTAATTAATAAGAACAATATCATTAATTTTGTTAAA
TTTTAGTTTTTCAAATTAAGAAATTCTAAAAAAATTAACATAGCTCAGTATATTAAATAA
AAATTAAAATCTTTGTATTTTAAAAATAGAATATGTCCCAAGAGATTCTTCAATTAAAGC
AAATACTCAATGATCCTAAAAATAAAGAAATCAAACCATTAATTTATGGTAGAGATAATA
TCGATGATGAAGGTAACAGCTAAGAAAGTGATGAAATATAAGACCCTGATTTACATAAAG
AAATAAACTATCCTAAGCCAGAAGAGTTAAACCACATAATAGGACCAGCTGACATTCTTA
AAGATTTAGGCCCAAGTGCACTATCTTCGATGGATAACTTAGTTAGAAGTTTATCATAAT
TTTAAAAATGGAGCAATTCTGATGTTTACCTCTCTCTCGAATTGATAGCATAAGACCCTG
TTTAATTAGGTGATGAATAAACTCAGCGTTTAGCTAACAATATTCTCCAAGTTGAATCCA
AAAACAGTAAAATTTTACACAAAAATTACAAATTTCAATAACTTTTTTTTCATTTTTTCA
AGGTTAACAAGAATGGGGTAATTTCACTAATTAAGATTAATCAGATAAAAACTAATAAAG
CGATTGGAATGCTGAGTTATTTATTGAATTCCTAATGAAGAAGATATTCCCTCAAAACAA
TGAATTAAATGTAATTACTTATTCAATACTTTAATAAAAAAAATTTAAAAGCAAGAATTT
TATCTTATTTATTAATAAGTAGTAGTATAAAAATTTAAAGTAATAGCAAATTCTAAAAAA
AATTGAAAAAAAGCATCTAAAATTTTGTATAACAAATATCAAAAAAGACCTCTAAAATAT
TTAAGCATAGAACATTTTTAAAAACTTAAGCAGCATCTTATACATATAAATTAATTCAAG
CATAAATAGCAAATAGTGTTAATAAGAAGTAAATAAATATAAAGAAAATGCTAAAATTAG
TAATTTTCAAATAGCTTAAATTCTATTTATTATGAAAACAATTAAAAAATAATAGTTTCA
AATCAAATCAATAATTTAAATATTAATTTCATTAAGAAACGATAAATACTTTACCTTAAA
TATATTTTTGATTAATAATTTTTTGGCATGTAAAAAATAGTCAAATATAATAATAAAATT
ATAATTAATTACTTTTTACTTTTTTTCAAATTTTTAATTATTTTTTTGTTTAAAATAGTG
GGTTTCCGTATTGACAGAAATTGATAGACCTTATTTGAAATTGAAGGACGAAAAATCTTT
TAAATAATTCTTTACTAATATGCTATTAATTCACAAAAAAGCTCCATTTTAAATGCCTGC
ATATTTGTTACTCAAGCCTTGGAAGAATATTAGAAGCCAAGCCTTATTCTTAAAGAATAT
GCTAGCTGTTGGTTCTTCTGAATTAGTAAGATGGAACGAAATTTAAAAAAATCCTATGAA
TTTAGAATTCAATCCATAATATAAATATAACACACTACCTTCTCCTATGCAGTTCTGGGC
CTGCTTGGATTTCCTCGATTTATTGTGTGAAATTAGTGAAGGAGATAACTATATGGCTAT
CCATGAGTTATTTGAGCTTCCTATTGCAAAATATCCAGATATCTTAATAGTCGCTTTATC
TTAACTGCATCCTAAAAAAGGTGCAAATCTCTTAGATGAAGTATTCAGTCAACTATTTCC
TAATTATTTGTCGAATCACATAAATTCTGTAGCTATTTTAGAAGCAATTTGGAAGAATAG
AGAGGATTTGCTTATTTCTGCTATTAGCGAACTTTATAGAAAAGAAAACAAGAAAGAAAA
CACATCTTTGAATTTATCAAGAGTCCTTGATATTTCCTAATATCTAAAAGACTCTTTAAT
TGCTCTCACAAATAGTAACAACTACTCTTTTTCTGTATCACTTGGTATTTTAGCTGGTAA
GAGAGAATTCCTACACTTTGACTAATGGCTAAATGAGCGTGTTAAGACTATTGGGGATCC
ATTTGTAAATGCTCTACTAGCATATATCGAAGACAATGTTATTAATCCAATTAAAGAAAT
AAATATGAGACTAAACAACCCCAACAATTAAGCTTAACAGTAATATGAAGGTGTTTTAGA
AAAGGCCTAACTAACTATTGAACTACTGACTATTATTTTTGAATCTCTTCTATTAGAGTA
ACACCCTGAAAAACTTACTAGCAAAAATCGTTAAAAGTTGTAAGATCAATATAAAGAAAT
ATTGTAATATTTCCCCTAATTAAGTGGAACTTCGGATTCACCAGGACAAGCTACAGAAAA
AAAAGCCAATTACAATTACCAAAGATTTTATATGAGAGAAATAACAATAGAGGAAATGAT
TGCAAATTTAAAATAATTAATGAATTCCAACAACTCTGAAGACAAAGAAGTGTTTGCATG
CATGATCACAAGCTTGATTGAAGAAGCTAAATACCACTAGTAATACCCCATAGCTGAGCT
TCTTTTAACAGGCTAACTCCAAGGAAGCATCATAAATGCACAGTAATTTAAAATTTATAA
ATTAGACTAATTTAATTATTCAATTAGCTTTAACTATTAATTATTTTTATCAATTTTATT
TATTTTATTTTTTTATAAATTTTTTTAATTAATTTGTTCACTTTTAATAGACTTGTCAAC
TAGAAACCATTAGGCATTATGCTAGAATAAATTTTGGAATCATCAAAAAAGACACAGAGA
TAAGTTGAGTAATCAGTAAAAGCAATAGAAGCTATGAAAGATCGCCTTCATGAATTCCCT
TACTTTGTAAATGCTCTTTTCGACCCATCCTGCCATCTTTCTGAGCAATTTCCTCAACTT
CTAATTAATATTTATAATGTAATTAAGTGTTTTACTTTTATTTATTTATTGACTTATTCT
TTTTTAATAAAGATTATGATTGAGAAGAAGGTATAAATTAATGTAACTAGTAAGCAAATT
GAATAGCTTAAATAAAGAGTAGAATCCCTTAAAAATGAAGCAAACAAACCATCTCAAACT
TACTAGGCAACAACAACTTAACAAGTAAACAATTTCAATCTAAAATTTTCCTTTTTACAA
TTGACTTTATTTTTTTAATAAAAAAGAAGAAGATCTTAAAGTTAAGAGGAGAAGTAGAAA
CTTCATCTGAAAATACCTCCTAACAACAATAAAATCAACAAGCATAGAACTAAGCTGCTG
CTGTAGCTCAATCTGATTAATCATCAGCACAGCCATAAGCATAAAATTAATAATAGTAAT
AACCATTATAGCAATAGGAAGGAAGTGCTTAGACAAAATAACAACAAGAATAAGATACTA
AAGCAAAAGCTGATTAGAATAACTAGCCTAGAAATCCTAGTGTTTAAAATGTAAGCTAAT
AAAATTTAGGTGAAGAAAAATAACCTTCTGATAACACCACACAAAGTAAAGGTAAAACTA
AAAAGCCTCTTTTTGCTGGATCTTCCGTATTTCCTTTGAGCAATTTAACTGCAAACTAAC
CAAAAATGGTATTCGAAAATCCTATTAATCAATAGATGAGATTCTAAGATACTTAAATAG
GAATGTATGACCAAGGATTGTATAATAATAATAATAATAGCACTAATAATAACAATAATG
GCAATAATACAGAAGAGATAGTTGTAAAAGCAAGACCTTACTAAGGAGGTGTTGGTTTTG
TTTAAAGACCTATATTTACAAACGGTGAACAATAAATCTATGCTTCTAAATCTATTAATG
AAATTTTAGAATATGAAAACTCACTTTAAATAGATGAATCAACAAAGATGAGAGTTAATT
TTGCACTAAATAATTTATCAGATGGAAACATAGAGAAACACTAAAATGATTTTAGAAATT
ACGCAGAAAATGAAAATTTTTAGAAATGGTTTGCTAGGCATCTTGTCACTCAAAGAGCTA
CTTTGAAATCAGAAATTAATGTCTTGCTGTACACTAAGCTCTGTGAAAGAATAGATAAGC
CTAAACTCTTTTCCTTTATCATAAAAGATTCTTTGTTACTTTTGCACAAACTTCTCTTAT
CAGAAGCTGCCATTCATGCTTCTATCCGTATTACCACTCTTAAAAATCTAGCTCATTGGA
TAGGCATGTTTACTTTGAATCGTAACAAACCAATCAATTCAAAATATTTGAATATCAAGG
CATTAATTGTCAATTCTTATCCGAACAAAGTTGATGTAATTATTCCTATTGTTATCAACA
TTCTACTTTGCTGTAAAGAATCAAAGATTTTTAATCCTTAAACTAACCGCTGGGTCAAGC
GTATTCTTTCTCTCTTAGAAGAATTCAAAAATGTGGTTCAGAAGGAAACTGTCAAGCATC
AAATTAATCAGTTGTTCTCTAATTTATAAATTGACGTAAATAGTTTAGAACCTTGTACCT
ACTTTAGATACTACTTACAAGAAAGTAAAAAGGAAGCTAAGCCAGCTTAATAGCCTGCTA
CTATTGTTTCTTTTTGCATCCGTGATAGACTAATAATTACAGATGATCTTCGCAACCTGT
GCAATATTTAAAACTTTGACTTAAAGTAAGCAGTTTTCCAATCCTTAGACGAAGCAATCA
TGGAAATTATACAACCAGTAATTTCTCGTAGTGTTACTATTGCCTTAGTCACCACTCGTG
AATTAGTCTTAAAAGATCACTGCACTGATCCTGATGAGAACAATCTTATAAATGGCATCT
CTAACATGGTTTAAAAACTATCTGGCTGTCTTGCTTTAATCACCTGCAAAGATCCACTCA
GATCAAGCTTCCAAACCCACTTAAAGACTAATTTAGAAAAAGTGACTGAATTAAATGCCA
ACGAAAAGGAATAAATCATTAATAAGGTAGTTATCGATAACATTGATATTGGCTGCCAAG
AAATCCGCTAAAGAGTAATGGATTAAGCTCTTAAGGAAATAAAATAAGATGATGCTATCC
TTGAAGCTATTGAAATGAGAAGAGCCGCAAAAGAAAAGTAGTAAGTATTTGTTGATGAAA
GATATTACAAGTTCACCAAAAACCTTCCTCCTGCTTTACAACCTAAATTCCCCAGCTCTT
CTGGTATATATTTTTGAATATAAATTTAATAAAAATAATAATTAAATTAAATAAATAAAT
AAGCAGCATACTCAGAATTCGATAGAACTTCTTTAAATGAAAACTTGGTAAGCGAATACA
ACACATAAACTTTAGAATAATTCAAAAAGAGTAACATTTTAAAATTAAAAAGTTTGTATT
AAATCCATATTTCGTTTAAATCTCTTTAGTTGTCAACAATTTTAGTCCAGAACAACCTGA
AAATGTAATTCTTACTCCTATTGAAGGATTCTTTAAGAAGATCATGTTCTCTGATAAGCT
ATATAACGAATTAATTGAATTAAATTTCTAATTGATGTACCAAAGCGAGGGTGCTTCTAA
GATTAGATTATTTGTTGAAATTCTTGACAAATTACGTGAACAGCACAAAGGAAAAGACAA
AATTGGCAAATTATTAAAAGATAATTTAATGAACAGTGCTCCTCTAGACAATCTGATTAA
GACCAACCTTCATATAATTTTGAATAGCCTTTTCATAAAAAGAATAATAACTAATAAAGA
ATATCAAGAAGTACTAAATTTATAAATAACATTTTTATTTACTTTTAATTATTTTCGATA
TAATTTCTTTGATATAATAAATAATTGATTATACTAAAATAAAGATTATGTTGCTTCTTG
TTTCTAGAAATCAAAGCAATGATATGATAATATGTTTGGTATCTGCCTTGAGAGAGCTTA
TTTTTGAGAAAAAGGAATACACTCCTTAAGATTTTAATGACTCAATTATTGCTCTTAAGT
TAACAATGTCTAGTAAATAAGACATTCCTCCTCATTACTCCTAGTTCTTGCAAGACCTCA
ACAAAATTGCATCTGAAAACTCTAATTAATCAAATAACATTATCACCTTTGAGCGTGCTC
TTGATGTTATTACCAACTTCTATGGCAATTTCGATAAAAAGCAGTATGAAGAAATATAGG
AGAAGGTTGAAAAATGGCTTTCTTTGTCAACTGAAGTTCAAATGGGCTAATTCATTTAAG
GCCTTGTTAATATTATCATTGATAATCATGATGAAAACTCTTTAAAATTCTTTGTCTACT
TTGCTGATATCTGCATCAACTACTCCTTAGAAAGCGCGTAAATAATCTTTTTTTATTGTT
TTAAATACAAGTCTTACTTATTTAATATATAAAACAGTAAAAAGAATTAAAGAATTAGCA
TACAAAATATTACTAGTATGGACTTTACTTGCGTTGATAGTTTCACAAAATTGATTGAAA
TTATTCAAAAGACTTGCAAAATTGAACAATATAAGAAGCAATTACTTAATCAAATTTTCG
ATAGTATATTCATCACATTGACTAAATATCATGAAACTGATATGTATGAATTCAACCAGC
GTCCATTCTTCCGTATCTTCTTTAATTTAATTTATGACAACCAAAGACCTAAATACGATT
TCTCTAAGAATGAAATATCTGAAACTTACAGCATGTTGGCTAACATATTCCATCAACTTT
CCCCTGTAAAATACCCAGGATTTGCTTTCTCTTGGTTAGAACTCATTTCAAATCGTTACT
TCATGCCAGTGATTATGGAAAAGGTAAAATTTAAAATAAAACATAAAATAAAATTTATTA
AAATTTATTTGTTTATCATTTATTATAGGAAGAATTGTGGGGATTATACAGCCAACTCAT
AATAGATTTAATCAAATTCTTTAAAGAAATAATGCAAGAAGAAAACCTTCAATTAGAATA
CATTAAGATATTCTACAGAGGCACCATTCGTATTTTACTTGTCTTGCTTCATGACTGGCC
TGATTTCTTAGCAAAATACTCTAATTCTTTATGTGATGAAATTCCTGAAAATTACATTTA
AATTAGAAACATTATTCTCGCTGCTTTCCCTAAAACTATGAAGCCACCTGATCCGTTCTC
AAACAAAAACGAACAAGTAAATATTTTTTTGTTTTTATTAGCTAAAAAATTAAATCTATT
AAATAGATCTTTGAAAACAATGAAGACTTTAAGAATCCTCCTATTATGGACTACCCAGTT
TATAATGAAAAAATCCAAGTCGATCTCATGAATGATCTTCAGAATTATCTTCGCACTAAG
AGCGAAGATATTTTCAAGACTATTTGCTCTAAATTGACTCTTAAAGAAAAATCATAATGT
AATTTTTTCAATAAAAAAGTGCTATGAAAACTAAATATACTTTAAATAAATATAGTTGTA
ATTGATTAGAAGGCTGTTAACATACTCATTTTGGCTATACCTTTGCATTTACACAAGCAA
TCTGTAAATTAAGGAAATAAGGATACTAAAACAATCCCTCTAAACAACGATTTATACAAT
TTCTTACTTGTAAATTATTATTGAAAATTAAAACAATAAATTTATTAAATTTTGATAAAA
AAATAGAAATTGCTTAAAACAAGTCATTACGAAATGAGAGAAGTAATTCTTAACTTGATA
ATAAATCAAGTTAGATATCCTAACTTTATCACAAAGTTCTACATTAAATACATTCTGTTG
ACATTCTAAGAACAAAATATTAATGATATTTAAGAACAAACCATTCGTATCATTGTAGAG
AGATTGTTTGTATAGAAACCTCACCCTTGGGGCATAATCTACACATTTATTGAGATCATT
AAGTCTAATTCTAATTTCAGATCAAAGCCTTTTGTCAGAGATGCTGAATTGAAATAAGTT
TTCCGCTTCATCTACTAAGAACCACCCAGATAAAGACCACCTCAATAATAGTAATAGCAA
CCATCATAACAACAGATTGGTCAGCACATACAACCTCAAGAGATGAACATAGATCAGTAA
ATGCACATGAATAGTATTTAGTACTAGCAGATATTGTAATAGCAACAATAGTAACAATAC
TAGCAACAATAGCAATATCAATAACAAATAGCAGGAGCTATAAGCCATCCTAACTATGTT
AATAGAAATAATTGA