Identifiers and Description

Gene Model Identifier

TTHERM_00628420

Standard Name

NOP7 (Nucleolar protein 7)

Aliases

PreTt24668 | 88.m00136 | 3822.m00657

Description

Nucleolar protein involved in rRNA processing and 60S ribosomal subunit biogenesis

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_00628420

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17281.19.997093137033517e-262pescadillo family protein (594
aa)
OxytrichaContig6540.0.g484.999822746981985e-134Pescadillo N-terminus
WormBaseWBGene000030635.000356947592888e-100locus:lpd-7 Pescadillo homol
og status:Confirmed UniPro
t:Q95Y89 protein_id:CCD63607
.1
SGDYGR103W1.9995541014149208e-99NOP7 Component of several diff
erent pre-ribosomal particles;
forms a complex with Ytm1p an
d Erb1p that is required for m
aturation of the large ribosom
al subunit; required for exit
from G0 and the ini
tiation of cell proliferation
DictyBaseDDB_G02894154.000179013191958e-98DDB_G0289415 on chromosome: 5
position 2775105 to 2777239
Stentor CoeruleusSteCoe_149582.2856936767186716e-49

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00628420(coding)
ATGGTCAAGAAAGTTATGAAAAATACTAGGGGCGAGGCCACCAAGTATATATCCAGAGCT
AAAGCTATCAAGAAGTTATAGGTTAGTTTGAAGGACTTCAGAAGATTATGCATCTTGAAG
GGTGTTTATCCCAGAGAACCTCCCAAAAAGTTGTAAAAGTAAAACAAGACCTACTACCAT
TTGAAGGATATCAACTACTTGATGCATGAAAAGATTCTTAACAAGTTCAGAGAATTGAAA
ACTCACATGAAAAAGGTCATGAAACTCAAGGCTAAGGGTGATAAGACTAGACTTAGATTA
CTTTAGAAATAAAAGCCCACTTACTCCTTGAATCATCTTGTTAAAGAAAGATATCCTACT
TTCATAGATGCCTTAAGAGATTTAGATGATCCTTTGTGCTTAGTTAATTTATTCGCAAGT
TTCCCTGCCCATAAGGCTCTCGGTGTTCCTAGAGACAGCATCACCAAGTGCATTAAGCTT
ATGAGAGAATTCAATCTCTTCGTTATTAAGAGCAAGAGTTTAAGAAAGGTCTTTATTTCA
ATTAAAGGTATCTACTACCAAGCTGAAATTGAAGGACAAAAGATCACCTGGATCGCTCCT
TTCTAACTCCCTGCCGAATTACCTGCTGAAGTTGACTATAAAGTTATGTTAACTTTCTTG
GAATTCTATGAAACTTTAATCAAGTTCGTTAACTTCAAGCTCTTTAATTCTATCAACGTC
AAGTACCCATTAGAAATAAACAAATCTATTGAAGATTAGAGTTACTTCTCTTATTCTTCC
TTTGTTCTCAAGCACAAGGATAGCCAATAAACTATTGAAAATGCTGAAGAAGAAAACGAA
AAATACGCTATTGATGACAAGTTTAAAAAAGACTAATAAATTTAAAAAATGACTAATGAC
AACAGCACCTCTTCTTTATTTAAGAACTGTGTTTTCTACCTCTCTTCAGAAGTTCCCAGA
CTTTCAATCGAATTTATAGTCCTCGCTTTCTCTGGTAAAGTTCACTGGGCTGGTGACGAC
TCTGAAGTCTAATGGAATGACCCTTCCATCACTCACTTTGTTACTGATAGAGATCCTAAG
ACTCTCTAAATTATTAAAAATAGAGAATATATTCAACCCTAATGGATTTATGATAGCATT
AATTCTGGAATTCTTTTACCTGTTGGTGAATATGCTCCTGGTAAGAGTTTACCTCCTCAT
TTATCTCCTTTCGTTGAATACAACGAAACTGAATACAAGCCTGAAAGACAAAAACAATTA
GATTTACTTAAGGGTGTTGAGGCCGAATTAAATGAAGAAGATGAAGAAGATGTTGAAATA
TCTGAAGACGAAGATGAAGAAGAAGAATAAGTTGAAGAGGAAAATGAAGACGAAGATGAA
GAAGAAATCGAAGCTGAAGAAAATGTTGAAGAAGATGAAGAAGAAGATATTGATGAGGAA
GAAGAAGATGATGATGAAGAAGAAGAAGAAGTTGACGGTGAAGAAGAATTAGAAGAAGAT
GATGATGACGAAGAAGACGAAGAAGAAGAAATTAACTATGATGAAGAAAGTGACGTTGAA
GACATTAAAAAGTAAGATGTTGAAGAATCAGAAAATGAATATGATCATGAAAAAGAATAA
TAAAAGAAGGCTAAAAAGTAAATAAAAGAAACAAAAGAATAAAAGGAATTAGCTAAGGCT
CTTATGACAAGAAAGAATAAAAAAATGTACGAATTGATATAAAAATCTAAGCAAGATAAG
TTATAAAAAGTAAAGGAATTACAAAAGAAGGCTGCCAAACTTAAAAATAAGGCCAAGAAA
AACTGA


>TTHERM_00628420(protein)
MVKKVMKNTRGEATKYISRAKAIKKLQVSLKDFRRLCILKGVYPREPPKKLQKQNKTYYH
LKDINYLMHEKILNKFRELKTHMKKVMKLKAKGDKTRLRLLQKQKPTYSLNHLVKERYPT
FIDALRDLDDPLCLVNLFASFPAHKALGVPRDSITKCIKLMREFNLFVIKSKSLRKVFIS
IKGIYYQAEIEGQKITWIAPFQLPAELPAEVDYKVMLTFLEFYETLIKFVNFKLFNSINV
KYPLEINKSIEDQSYFSYSSFVLKHKDSQQTIENAEEENEKYAIDDKFKKDQQIQKMTND
NSTSSLFKNCVFYLSSEVPRLSIEFIVLAFSGKVHWAGDDSEVQWNDPSITHFVTDRDPK
TLQIIKNREYIQPQWIYDSINSGILLPVGEYAPGKSLPPHLSPFVEYNETEYKPERQKQL
DLLKGVEAELNEEDEEDVEISEDEDEEEEQVEEENEDEDEEEIEAEENVEEDEEEDIDEE
EEDDDEEEEEVDGEEELEEDDDDEEDEEEEINYDEESDVEDIKKQDVEESENEYDHEKEQ
QKKAKKQIKETKEQKELAKALMTRKNKKMYELIQKSKQDKLQKVKELQKKAAKLKNKAKK
N


>TTHERM_00628420(gene)
ATGGTCAAGAAAGTTATGAAAAATACTAGGGGCGAGGCCACCAAGTATATATCCAGAGCT
AAAGCTATCAAGAAGTTATAGGTTAGTTTGAAGGACTTCAGAAGATTATGCATCTTGAAG
GGTGTTTATCCCAGAGAACCTCCCAAAAAGTTGTAAAAGTAAAACAAGACCTACTACCAT
TTGAAGGATATCAACTACTTGATGCATGAAAAGATTCTTAACAAGTTCAGAGAATTGAAA
ACTCACATGAAAAAGGTCATGAAACTCAAGGCTAAGGGTGATAAGACTAGACTTAGATTA
CTTTAGAAATAAAAGCCCACTTACTCCTTGAATCATCTTGTTAAAGAAAGGTAATCCTAC
TTTCCTCAATTTAAAATTAATAAATCAGAGTGATTGCAAAATCAGCAAAGTGTTTGTGAG
TTTATATCATTTTTATGTCAATGCAAGATGATATAAATGTTCACCAAACAATTAAGATAA
AAAATGCTAATTTTTTTGTTAATTTCATTTAAAAATGATAAATTATTAATTAAAAACATA
GATATCCTACTTTCATAGATGCCTTAAGAGATTTAGATGATCCTTTGTGCTTAGTTAATT
TATTCGCAAGTTTCCCTGCCCATAAGGCTCTCGGTGTTCCTAGAGACAGCATCACCAAGT
GCATTAAGCTTATGAGAGAATTCAATCTCTTCGTTATTAAGAGCAAGAGTTTAAGAAAGG
TCTTTATTTCAATTAAAGGTATCTACTACCAAGCTGAAATTGAAGGACAAAAGATCACCT
GGATCGCTCCTTTCTAACTCCCTGCCGAATTACCTGCTGAAGTTGACTATAAAGTTATGT
TAACTTTCTTGGAATTCTATGAAACTTTAATCAAGTTCGTTAACTTCAAGCTCTTTAATT
CTATCAACGTCAAGTACCCATTAGAAATAAACAAATCTATTGAAGATTAGAGTTACTTCT
CTTATTCTTCCTTTGTTCTCAAGCACAAGGATAGCCAATAAACTATTGAAAATGCTGAAG
AAGAAAACGAAAAATACGCTATTGATGACAAGTTTAAAAAAGACTAATAAATTTAAAAAA
TGACTAATGACAACAGCACCTCTTCTTTATTTAAGAACTGTGTTTTCTACCTCTCTTCAG
AAGTTCCCAGACTTTCAATCGAATTTATAGTCCTCGCTTTCTCTGGTAAAGTTCACTGGG
CTGGTGACGACTCTGAAGTCTAATGGAATGACCCTTCCATCACTCACTTTGTTACTGATA
GAGATCCTAAGACTCTCTAAATTATTAAAAATAGGTAAAAAATAAATAAATTTATTAAAC
AAATTTTGTGAATAAAAAAGATTCTTTCTTCTACTTAATTACTTACTTACTTATAAATAG
ATTTAAATTAATTAAAATTTAATAAAAATAGAGAATATATTCAACCCTAATGGATTTATG
ATAGCATTAATTCTGGAATTCTTTTACCTGTTGGTGAATATGCTCCTGGTAAGAGTTTAC
CTCCTCATTTATCTCCTTTCGTTGAATACAACGAAACTGAATACAAGCCTGAAAGACAAA
AACAATTAGATTTACTTAAGGGTGTTGAGGCCGAATTAAATGAAGAAGATGAAGAAGATG
TTGAAATATCTGAAGACGAAGATGAAGAAGAAGAATAAGTTGAAGAGGAAAATGAAGACG
AAGATGAAGAAGAAATCGAAGCTGAAGAAAATGTTGAAGAAGATGAAGAAGAAGATATTG
ATGAGGAAGAAGAAGATGATGATGAAGAAGAAGAAGAAGTTGACGGTGAAGAAGAATTAG
AAGAAGATGATGATGACGAAGAAGACGAAGAAGAAGAAATTAACTATGATGAAGAAAGTG
ACGTTGAAGACATTAAAAAGTAAGATGTTGAAGAATCAGAAAATGAATATGATCATGAAA
AAGAATAATAAAAGAAGGCTAAAAAGTAAATAAAAGAAACAAAAGAATAAAAGGAATTAG
CTAAGGCTCTTATGACAAGAAAGAATAAAAAAATGTACGAATTGATATAAAAATCTAAGC
AAGATAAGTTATAAAAAGTAAAGGAATTACAAAAGAAGGCTGCCAAACTTAAAAATAAGG
CCAAGAAAAACTGA