Identifiers and Description

Gene Model Identifier

TTHERM_00499610

Standard Name

NOP2 (nucleolar protein NOP2)

Aliases

PreTt08004 | 63.m00182 | 3716.m00036

Description

NOL1/NOP2/sun family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF01189 ) NOL1/NOP2/sun family
  • ( TIGR00446 ) NOL1/NOP2/sun family putative RNA methylase
  • ( TIGR00563 ) ribosomal RNA small subunit methyltransferase

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 14.7%

TetraMine Data

TTHERM_00499610

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_09671.19.997093137033517e-262NOL1/NOP2/sun family protein (
394 aa)
OxytrichaContig3524.0.g376.001562532268269e-106NOL1/NOP2/sun family
DictyBaseDDB_G02816851.0004572433669413e-23nol1 on chromosome: 3 position
4810538 to 4812581
WormBaseWBGene000210731.999598840915195e-17locus:nol-1 status:Confirmed
UniProt:Q9TYV5 protein_id
:CCD73642.1
SGDYNL061W2.0004286606204839e-16NOP2 Probable RNA m(5)C methyl
transferase, essential for pro
cessing and maturation of 27S
pre-rRNA and large ribosomal s
ubunit biogenesis; localized t
o the nucleolus; constituent o
f 66S pre-ribosomal particles
Stentor CoeruleusSteCoe_201830.000000002061153622438558

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00499610(coding)
ATGATTAAAAAATTTATAAAAGGACACATTAGCAAGTTTCTAAACTTATGGTAGTAGGAA
CTAGAATTAAAAAAAGAGTAAGCAAACCCAATAGACTCAATGTTAAGAAACTACCTTAAA
GAAAATAAAGCATTAGGCAGTAATGACAGAAAATTATTTACTGATAATGTTTACAAGCTA
GTTAGACATAAAGTGTATTTAGATACGATTTCACCCAAACCACTGTCATGGGAAGGCCGT
CTTGACACTATTTATACAGAGAAATTTGCTACATAAAGAAAAAATATGTCACTTTTACCT
CATGTGAGAGCAAGCTGTCCAAAAGATCTATTTGATGTTCTTTGCGATTCTTTTGGTGAA
GAAAAAGCAATTGAAATATGCATGGCATAAAATCTAAGGGCTCCTTTAACAGTCAGAGTA
AACCCTATAAAAATATCAAGAGAAGAGCTTATTTAAAAGTGGAGAGATGTGAACAAATTT
GCAATCAAGCCTACTGAGTTCTCTCCTTACGGAATAACATTTACAACAGACAAAAACGAA
AACTTGTATGAACTACCAGAATTCAAAAGAGGTTATTTTGAAATTTAGGATGAAGCAAGT
CAACTTGCAGCATTTAAAGTGAAATGTCAAATAGGTGACCATGTCTTAGACTATTGCGCT
GGTGCTGGAGGAAAATCTTTAGCTTTTGCGCCTTATCTTAAAGGAACAGGTTAAATCTAT
TTGCATGATACAAGAGACTATATTTTATAAGAAGCTAAAAAAAGATTTAATAAAGCTGGA
ATTCAAAATGTTCAATTTCACACATAAGAAAGCTTAAATAATAATAAAAATAAATTAGTT
AAAAAATTTGATTGGGTAGTATGTGATGTACCTTGCACTGGTACAGGTACATTGAGAAGA
AACCCTGATTTGAAATATAAATTTTCGAGAAATAGACTAAAATATTTTGTAGATTTGTAA
GCAAGTGTTTTCAAGGAGGCTCTGCCTTTTGTTAAACCTAAGACAGGAAAAATAGTTTAC
TCAACCTGTTCATTGCTTTAAGAAGAAAACATATTTTAGATCACAAAATTTTGTAAAGAA
TTTAATTTAGAAGTAGTAGATGGAAAGCATTTCTAAACAACCCCAGGCAAAGATGTAGAA
ATGGATGGATTTTTTTGTGCTGTTTTGCAATTTAAAAATTGA


>TTHERM_00499610(protein)
MIKKFIKGHISKFLNLWQQELELKKEQANPIDSMLRNYLKENKALGSNDRKLFTDNVYKL
VRHKVYLDTISPKPLSWEGRLDTIYTEKFATQRKNMSLLPHVRASCPKDLFDVLCDSFGE
EKAIEICMAQNLRAPLTVRVNPIKISREELIQKWRDVNKFAIKPTEFSPYGITFTTDKNE
NLYELPEFKRGYFEIQDEASQLAAFKVKCQIGDHVLDYCAGAGGKSLAFAPYLKGTGQIY
LHDTRDYILQEAKKRFNKAGIQNVQFHTQESLNNNKNKLVKKFDWVVCDVPCTGTGTLRR
NPDLKYKFSRNRLKYFVDLQASVFKEALPFVKPKTGKIVYSTCSLLQEENIFQITKFCKE
FNLEVVDGKHFQTTPGKDVEMDGFFCAVLQFKN


>TTHERM_00499610(gene)
ATGATTAAAAAATTTATAAAAGGACACATTAGCAAGTTTCTAAACTTATGGTAGTAGGAA
CTAGAATTAAAAAAAGAGTAAGCAAACCCAATAGACTCAATGTTAAGAAACTACCTTAAA
GAAAATAAAGCATTAGGCAGTAATGACAGAAAATTATTTACTGATAATGTTTACAAGCTA
GTTAGACATAAAGTGTATTTAGATACGATTTCACCCAAACCACTGTCATGGGAAGGCCGT
CTTGACACTATTTATACAGAGAAATTTGCTACATAAAGAAAAAATATGTCACTTTTACCG
TAAATTAATTCATTATAGATATACTTTTTAGATTAACTTTAAATTTAAAAAAATAAATAG
TCATGTGAGAGCAAGCTGTCCAAAAGAGTTAGTAGATTTCATTAACTTTAAAAAAGCATT
TATCTATGCCAATAAAATAATTAATGTACATAAAAATGATTATTAATTTATAATATAGTC
TATTTGATGTTCTTTGCGATTCTTTTGGTGAAGAAAAAGCAATTGAAATATGCATGGCAT
AAAATCTAAGGGCTCCTTTAACAGTCAGAGTAAACCCTATAAAAATATCAAGAGAAGAGC
TTATTTAAAAGTGGAGAGATGTGAACAAATTTGCAATCAAGCCTACTGAGTTCTCTCCTT
ACGGAATAACATTTACAACAGACAAAAACGTAAAAATAAAATTAAAAATATATAGATTTG
ATATAATGGTTTTAATTAAAGAAAACTAGAATCTTCTACTGAAGATTTATATCTACTTTT
CAAAACAATTTGATGTTATTTAATTTTTTATTTCTTACAGGAAAACTTGTATGAACTACC
AGAATTCAAAAGAGGTTATTTTGAAATTTAGGATGAAGCAAGTCAACTTGCAGCATTTAA
AGTGAAATGTCAAATAGGTGACCATGTCTTAGACTATTGCGCTGGTGCTGGAGGAAAATC
TTTAGCTTTTGCGCCTTATCTTAAAGGAACAGGTTAAATCTATTTGCATGATACAAGAGA
CTATATTTTATAAGAAGTAATCAATCAATTAATTAATTTAAAATTGGAATAGTTTTAATT
TAAAAATATTTTATTTGTCTATTTAATAAAAAATATACTTTTGACAACTTTATTAATAAT
ATCTTATAAAATGAAAATAGGCTAAAAAAAGATTTAATAAAGCTGGAATTCAAAATGTTC
AATTTCACACATAAGAAAGCTTAAATAATAATAAAAATAAATTAGTTAAAAAATTTGATT
GGGTAGTATGTGATGTACCTTGCACTGGTACAGGTACATTGAGAAGAAACCCTGATTTGA
AATATAAATTTTCGAGAAATAGACTAAAATATTTTGTAGATTTGTAAGCAAGTGTTTTCA
AGGAGGCTCTGCCTTTTGTTAAACCTAAGACAGGAAAAATAGTTTACTCAACCTGTTCAT
TGCTTTAAGAAGTAATATATTTTAATTTTAGTATTTAAATTAACAATTTTTCATTATAAT
TTAGGAAAACATATTTTAGATCACAAAATTTTGTAAAGAATTTAATTTAGAAGTAGTAGA
TGGAAAGCATTTCTAAACAACCCCAGGCAAAGATGTAGAAATGGATGGATTTTTTTGTGC
TGTTTTGCAATTTAAAAATTGA