Identifiers and Description

Gene Model Identifier

TTHERM_00590080

Standard Name

NOL9 (polynucleotide 5'-hydroxyl-kinase NOL9)

Aliases

PreTt24123 | 81.m00180 | 3726.m00056

Description

Ribosome Biogenesis Protein Nol9

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.4%

TetraMine Data

TTHERM_00590080

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16952.19.997093137033517e-262hypothetical protein (730 aa)
OxytrichaContig14748.0.g80.0000007001298633766835Molybdopterin guanine dinucleo
tide synthesis protein B

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00590080(coding)
ATGAAATATTTAAAATAGGTTTATGCAATTTCTTCTGGAACCAGAAGATACAGAAAACTT
AAAGCTCTTTAGTTCTATGCTAATTTACAGAAGAATGGACGTATAGATGATAGTTTTGAA
ATAGCTAAGAGGAAAAAAAATGCAAATTCATAGAAAAAACCAGCTAAGAAAGCTCAATAA
TCTTTAGAAGAATTTCTCGAAGAACATGATGTAGATGATAGCTTTGAATTAGCCAAAAAG
CATTACAAAAGTAAGAAGGAAGAGACAAAAAAATAAGCAGCAAGCGTCGAAAAGGCGATT
ACCAAAAAAGAAAAAAAGCAGAAAAAATAAGATTCTAAAAACGAGTTTCTTTCTTCAGAT
TCAGATTTAGAGTTAATTTAAGAGATTGAAAATGGTAGCAATTTAAAAAAAGAAAAAGTT
GAAGAATAGGATTTTTCATAACATATTATGGAACTACCTCATGGGGATAAGTTAGTATTC
GTATAAAATAAATAAAAAGTCATATTCACAGGAGAGTTTGAAGTTTGCTGCTTATACGGC
TAAGTACACGTTAATGGCTTGAGTTTATCAAGCAAAGATGTTTCTGATAAATAAAAAGTA
TTCATGCACAAAGCAAGTTCTTTATTAAAAAATAGTTTGCTTTCTTTTGACACTGTTTCT
CGTGATTCTACTATTTCAGACTCAAAGAATGCATCTAAATTATTAGAAATAATAAACCAC
AATGTTATTTTGATTAATGGAAAGCAAGATTGTGATAAAATTATTGATAAGATTTGTGAA
AATTTTGATGAAATCTAATAAAAGTTTACTAAAGGATTCAGTAATATTTTATACATTCAT
CACACTAAAGTTCTCAATCATCAGCTTATTCCTTTCAAAATCATTAATGTTTTGACCACT
GCTAAGCAATTTTCTTCTACTTAAAACTATATCTAATGGACAGAAAAGTAACAAAACTTT
GTTGAAGATGCTGTTAAATCTTTCACCAATACAAAAAACTAATCAAATGATGTTAAAAGT
ATGTTGATCTGTGGTACTAAAAATTGTGGTAAAAGTATGTTCACTTTATACAGCATAAAC
AGACTTTTGGATAACTTTGATAGAATATGTGTTTTAGATACAGATTTAGGTTAAAGTTTA
TTCCACTTTCCAGGAACTGTAAATTTGTTTAGTATGAGCAAAAAAGATATCCATTTGTCT
AACTTGACTCATATCCATTTCATTAAGCCTGTATTAAGTATATATGTAGGAGAATATAGT
CCTTAGTATTTTATTCAGTAATATATTGCAGGTATAAAGAAATGCTTTAAATTCTATTAA
GAGTATTTTAGAAATTGTCCTCTTATAGTAAATACTCACGGATATATCACAAATATTGGA
GAATTGCTGCTTTATGAAATTTAAGATATTATTGAACCAAAATTCATAGGTTTACTTAGC
ACAAATGAATAGTTGATTCAACACTTAACCAATAGCAATACTAGATTAGAAAGACTTTCT
CTAACAACAAAATCGAAAGATATGCCTAACTTCAAATCAAGAGTTGAGGATATTACTAAT
CCCAGCTTTGAAGCTAATAAAGTAAAGGTAAATGAAGCTAAGAGACACAGAAAAGATGAC
ATTATTTTCTAATATTTAACAAATTAAGTTAAACTTGATAATACTTATCCTTTCTAGAAT
TTATATTCATCTCAATATGGTTAATTATGTCTTTAAAAACCTTTTGAAGCTCCATTGAAC
TCAATTAAATACTATTTGTTGGAAACTTAAACTTAAATCGAAGGTAGCAATGACATTGCA
AAACATTTTAATTGCTCTATTGTTGCTTTGTTTGATTAGTCATTTTCTTTTAGTAACACA
ACTACTAATTGTATTGGATTTGCATTTGTTAGAGATATAGATCTTAAGAAGAACACTATT
GAAATCATCACAAGCTAATCGATTATTAATGATTTACCAAGAGTTTCAACATTTATAAAA
TCAAATGAGATGGCATTTTCTAAGCGTTTCTACCTGCAAAATTAACATTCTTATAATGAA
ATATCAGAACTCACTTATGATGTAAATGGTGATTTTTCTTCTAAGAGAACATTAGATGTT
CCTTTTGTTTTACCTAAATCAAGTGGTTTAGGAAATATCTCATTTAGATCAAGAGTTTCA
AATAGAAAATGA


>TTHERM_00590080(protein)
MKYLKQVYAISSGTRRYRKLKALQFYANLQKNGRIDDSFEIAKRKKNANSQKKPAKKAQQ
SLEEFLEEHDVDDSFELAKKHYKSKKEETKKQAASVEKAITKKEKKQKKQDSKNEFLSSD
SDLELIQEIENGSNLKKEKVEEQDFSQHIMELPHGDKLVFVQNKQKVIFTGEFEVCCLYG
QVHVNGLSLSSKDVSDKQKVFMHKASSLLKNSLLSFDTVSRDSTISDSKNASKLLEIINH
NVILINGKQDCDKIIDKICENFDEIQQKFTKGFSNILYIHHTKVLNHQLIPFKIINVLTT
AKQFSSTQNYIQWTEKQQNFVEDAVKSFTNTKNQSNDVKSMLICGTKNCGKSMFTLYSIN
RLLDNFDRICVLDTDLGQSLFHFPGTVNLFSMSKKDIHLSNLTHIHFIKPVLSIYVGEYS
PQYFIQQYIAGIKKCFKFYQEYFRNCPLIVNTHGYITNIGELLLYEIQDIIEPKFIGLLS
TNEQLIQHLTNSNTRLERLSLTTKSKDMPNFKSRVEDITNPSFEANKVKVNEAKRHRKDD
IIFQYLTNQVKLDNTYPFQNLYSSQYGQLCLQKPFEAPLNSIKYYLLETQTQIEGSNDIA
KHFNCSIVALFDQSFSFSNTTTNCIGFAFVRDIDLKKNTIEIITSQSIINDLPRVSTFIK
SNEMAFSKRFYLQNQHSYNEISELTYDVNGDFSSKRTLDVPFVLPKSSGLGNISFRSRVS
NRK


>TTHERM_00590080(gene)
ATGAAATATTTAAAATAGGTTTATGCAATTTCTTCTGGAACCAGAAGATACAGAAAACTT
AAAGCTCTTTAGTTCTATGCTAATTTACAGAAGAATGGACGTATAGATGATAGTTTTGAA
ATAGCTAAGAGGAAAAAAAATGCAAATTCATAGAAAAAACCAGCTAAGAAAGCTCAATAA
TCTTTAGAAGAATTTCTCGAAGAACATGATGTAGATGATAGCTTTGAATTAGCCAAAAAG
CATTACAAAAGTAAGAAGGAAGAGACAAAAAAATAAGCAGCAAGCGTCGAAAAGGCGATT
ACCAAAAAAGAAAAAAAGCAGAAAAAATAAGATTCTAAAAACGAGTTTCTTTCTTCAGAT
TCAGATTTAGAGTTAATTTAAGAGATTGAAAATGGTAGCAATTTAAAAAAAGAAAAAGTT
GAAGAATAGGATTTTTCATAACATATTATGGAACTACCTCATGGGGATAAGTTAGTATTC
GTATAAAATAAATAAGTAATTATTTTATTTGAAATTATAGTCACAATTAATATTATATCT
TTAAGATATTCTAACAATTAATATTATTCTATGTTTCTTTCATTGTTTAATAATAATTTA
CTATTTTAGAAAGTCATATTCACAGGAGAGTTTGAAGTTTGCTGCTTATACGGCTAAGTA
CACGTTAATGGCTTGAGTTTATCAAGCAAAGATGTTTCTGATAAATAAAAAGTATTCATG
CACAAAGCAAGTTCTTTATTAAAAAATAGTTTGCTTTCTTTTGACACTGTTTCTCGTGAT
TCTACTATTTCAGACTCAAAGAATGCATCTAAATTATTAGAAATAATAAACCACAATGTT
ATTTTGATTAATGGAAAGCAAGATTGTGATAAAATTATTGATAAGATTTGTGAAAATTTT
GATGAAATCTAATAAAAGTTTACTAAAGGATTCAGTAATATTTTATACATTCATCACACT
AAAGTTCTCAATCATCAGCTTATTCCTTTCAAAATCATTAATGTTTTGACCACTGCTAAG
CAATTTTCTTCTACTTAAAACTATATCTAATGGACAGAAAAGTAACAAAACTTTGTTGAA
GATGCTGTTAAATCTTTCACCAATACAAAAAACTAATCAAAGTAAGTTTTATAAATTTAT
TAATCAAGAATCTAATCATATTTATTGATATTTATTTATTCATTTATTAATTAATTAATT
AAAAATAGTTAAACAATAAAAAAATATATTTTTATAATATAATTTTTATTTTTATTTTAG
TGATGTTAAAAGTATGTTGATCTGTGGTACTAAAAATTGTGGTAAAAGTATGTTCACTTT
ATACAGCATAAACAGACTTTTGGATAACTTTGATAGAATATGTGTTTTAGATACAGATTT
AGGTTAAAGTTTATTCCACTTTCCAGGAACTGTAAATTTGTTTAGTATGAGCAAAAAAGA
TATCCATTTGTCTAACTTGACTCATATCCATTTCATTAAGCCTGTATTAAGTATATATGT
AGGAGAATATAGTCCTTAGTATTTTATTCAGTAATATATTGCAGGTATAAAGAAATGCTT
TAAATTCTATTAAGAGTATTTTAGAAATTGTCCTCTTATAGTAAATACTCACGGATATAT
CACAAATATTGGAGAATTGCTGCTTTATGAAATTTAAGATATTATTGAACCAAAATTCAT
AGGTTTACTTAGCACAAATGAATAGTTGATTCAACACTTAACCAATAGCAATACTAGATT
AGAAAGACTTTCTCTAACAACAAAATCGAAAGATATGCCTAACTTCAAATCAAGAGTTGA
GGATATTACTAATCCCAGCTTTGAAGCTAATAAAGTAAAGGTAAATGAAGCTAAGAGACA
CAGAAAAGATGACATTATTTTCTAATATTTAACAAATTAAGTTAAACTTGATAATACTTA
TCCTTTCTAGAATTTATATTCATCTCAATATGGTTAATTATGTCTTTAAAAACCTTTTGA
AGCTCCATTGAACTCAATTAAATACTATTTGTTGGAAACTTAAACTTAAATCGAAGGTAG
CAATGACATTGCAAAACATTTTAATTGCTCTATTGTTGCTTTGTTTGATTAGTCATTTTC
TTTTAGTAACACAACTACTAATTGTATTGGATTTGCATTTGTTAGAGATATAGATCTTAA
GAAGAACACTATTGAAATCATCACAAGCTAATCGATTATTAATGATTTACCAAGAGTTTC
AACATTTATAAAATCAAATGAGATGGCATTTTCTAAGCGTTTCTACCTGCAAAATTAACA
TTCTTATAATGAAATATCAGAACTCACTTATGATGTAAATGGTGATTTTTCTTCTAAGAG
AACATTAGATGTTCCTTTTGTTTTACCTAAATCAAGTGGTTTAGGAAATATCTCATTTAG
ATCAAGAGTTTCAAATAGAAAATGA