Identifiers and Description

Gene Model Identifier

TTHERM_00462830

Standard Name

NOC4 (NucleOlar Complex associated 4)

Aliases

PreTt25736 | 54.m00192 | 3823.m01104

Description

Nucleolar protein; forms a complex with Nop14p

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00462830

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10758.19.997093137033517e-262hypothetical protein (538 aa)
SGDYPR144C2.99851380290819e-19NOC4 Nucleolar protein, forms
a complex with Nop14p that med
iates maturation and nuclear e
xport of 40S ribosomal subunit
s
OxytrichaContig11478.0.g722.999758165421992e-18CBF/Mak21 family
WormBaseWBGene000206019.99946582325553e-18Uncharacterized protein T20B12
.3 status:Confirmed UniPro
t:P41843 protein_id:CCD69072
.1
DictyBaseDDB_G02754038.997498379799854e-17DDB_G0275403 on chromosome: 2
position 5403180 to 5405487

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00462830(coding)
ATGAGCACCGACATGAAATAAATATGCCAAGACATTATAACTTAGAAGAATGATTTAAAT
AAAATTAATGATTTGCTTAAATTTGCACTCTCTAACGATCAAGGCGATTAAGAAGAAGCA
ATTAAGTATTTAAGAAAGGTATTTAAGCTCTTCATTAAAGGAAAGAAGCTTATAGAATTT
AAGGATTTGACATCTTTTGAAATCTAAGTCAATAACACTTAGTATGAAGTTTTCTAAGAA
TTTTTAAAAAAGAAGTTTATTGCCTACGTTGAAATTTTAAAATCAAATATTTTCTCTACT
CGTATTGGAGAGAACATCAAGGAATTGAGTTTAAGAGTTCTTTTTGAGTTATCTCGCTAC
CACTTTGAAAGCATTCGCAATTCATAAAATATGGATTATTCTGACTAAACTATGCTTTAT
GATATTATGTTTAGCATTATTAGTGAAATAGATAAATTTGATGACATTCTCTTTGTGCTT
ATTGAATATATCTAAAATTATCCTGATTTTTCAATTGCTATATTGAAAATACTATCAAAA
ATTACAAAGAAAACCTCTTCTACAGATATTGATATGCAATAAAATATTATTACATTCACT
TAATACATTCCTTCACTTGAAAACTTAGAATTCAACTCCCTATTTCTTCAATTAGAAGCT
TAGAAGAAAAAAGTTGATTTGATCAAACGTAAAGCTGCTTACGATATTGATAGAGATGGT
AAATAAATTGAAAAACCAGAAATCGATTAAGAATTATATTTAAGAAAGTGGAAAGACAGC
TTCTCTGAATTTATATTTTCGATTATTTAGAAGTTAAAATAAAGCAATAATTAATAACTT
TTACTAAATTTTATATCTGGTTTCAGTAAATATATATTCCATAAGATGGAAGATCCTCTT
CTCCTCGCTAATTTCTTAGTTGATGTTTTTGATAGCACAAAAGATTTCAATATGCAAATT
ATAAGTTTGTCTTAGTTATTTATTTTAATTGGTAAACATTAACTTGAATATCCTAAATAT
TACCATAAGCTCTTCTCTCTTTTCGATCAAAACGAGAAAGCTAACTAAAGAAACTAAACT
ATTTTCTTAACTTCTCACACTCCTAAGTTCTTAAAATTAGTGGAAACCTCTTTAAAAACA
ACTAAACTCTCTCATAAAATATTATCATCTTTCATCAAAAAAATATTGAGAGTCGCTATG
GTCCATCCTCCAAACATCCTTTTATGGGCTGTCTCATTAACCATCAACATTATAAAAAAG
AACCCTACATTGGTTGCCATGCTTGATACTCAAGAATTGAAAGAGAAAATATAAGATTGC
TTTATCCCTGACTAAAAAGATTTAGATAATTGCTAGGCCTAAGAATCTTTCTTATGGGAA
TTAAAATCTATAAAAAACCATTACTTAAATGAAGTTGAAAAAATGGTTAAAGTCTTAGGT
ACAAAATTAGACGTAGCCTAATTTATAGAATTAGAAAGCTTTACCGATGTACAATATGAC
CACTTTATCCGCTTATATATAGATGCTGCTAAAAATAAAAAAGTTACTTTCCCTATAGAA
AATAAAATCGAAAACATTCAATAACTTTAACTAATCAACACAACTTTATTTGAATGA


>TTHERM_00462830(protein)
MSTDMKQICQDIITQKNDLNKINDLLKFALSNDQGDQEEAIKYLRKVFKLFIKGKKLIEF
KDLTSFEIQVNNTQYEVFQEFLKKKFIAYVEILKSNIFSTRIGENIKELSLRVLFELSRY
HFESIRNSQNMDYSDQTMLYDIMFSIISEIDKFDDILFVLIEYIQNYPDFSIAILKILSK
ITKKTSSTDIDMQQNIITFTQYIPSLENLEFNSLFLQLEAQKKKVDLIKRKAAYDIDRDG
KQIEKPEIDQELYLRKWKDSFSEFIFSIIQKLKQSNNQQLLLNFISGFSKYIFHKMEDPL
LLANFLVDVFDSTKDFNMQIISLSQLFILIGKHQLEYPKYYHKLFSLFDQNEKANQRNQT
IFLTSHTPKFLKLVETSLKTTKLSHKILSSFIKKILRVAMVHPPNILLWAVSLTINIIKK
NPTLVAMLDTQELKEKIQDCFIPDQKDLDNCQAQESFLWELKSIKNHYLNEVEKMVKVLG
TKLDVAQFIELESFTDVQYDHFIRLYIDAAKNKKVTFPIENKIENIQQLQLINTTLFE


>TTHERM_00462830(gene)
ATGAGCACCGACATGAAATAAATATGCCAAGACATTATAACTTAGAAGAATGATTTAAAT
AAAATTAATGATTTGCTTAAATTTGCACTCGTAAATATGAATTATTCTTTTGACATAATT
AATTACTTAATTTATTATCAAATATGCAACTCTTTTAAATTAATCAGAATAGTATTTTAA
GTCATTTAATTTCAATACTATTAAAAGTCTAACGATCAAGGCGATTAAGAAGAAGCAATT
AAGTATTTAAGAAAGGTATTTAAGCTCTTCATTAAAGGAAAGAAGCTTATAGAATTTAAG
GATTTGACATCTTTTGAAATCTAAGTCAATAACACTTAGTATGAAGTTTTCTAAGAATTT
TTAAAAAAGAAGTTTATTGCCTACGTTGAAATTTTAAAATCAAATATTTTCTCTACTCGT
ATTGGAGAGAACATCAAGGTAAAATTTAAATCATTTTTGTTTATTTATTTTATAATATTT
ATTTATAGGAATTGAGTTTAAGAGTTCTTTTTGAGTTATCTCGCTACCACTTTGAAAGCA
TTCGCAATTCATAAAATATGGATTATTCTGACTAAACTATGCTTTATGATATTATGTTTA
GCATTATTAGTGAAATAGATAAATTTGATGACATTCTCTTTGTGCTTATTGAATATATCT
AAAATTATCCTGATTTTTCAATTGCTATATTGAAAATACTATCAAAAATTACAAAGAAAA
CCTCTTCTACAGATATTGATATGCAATAAAATATTATTACATTCACTTAATACATTCCTT
CACTTGAAAACTTAGAATTCAACTCCCTATTTCTTCAATTAGAAGCTTAGAAGTAAATTA
ATTAATTCATTCATTCATCATTTGTTATCTTACTTATGAAACTTCTTTTGAATTAGGAAA
AAAGTTGATTTGATCAAACGTAAAGCTGCTTACGATATTGATAGAGATGGTAAATAAATT
GAAAAACCAGAAATCGATTAAGAATTATATTTAAGAAAGTGGAAAGACAGCTTCTCTGAA
TTTATATTTTCGATTATTTAGAAGTTAAAATAAAGCAATAATTAATAACTTTTACTAAAT
TTTATATCTGGTTTCAGTAAATATATATTCCATAAGATGGAAGATCCTCTTCTCCTCGCT
AATTTCTTAGTTGTAATGAAATTTAAAAGCATTTTGTTTTGGAAATTGATTGATATAATT
TTTTATAATAAAAAAGGATGTTTTTGATAGCACAAAAGATTTCAATATGCAAATTATAAG
TTTGTCTTAGTTATTTATTTTAATTGGTAAACATTAACTTGAATATCCTAAATATTACCA
TAAGCTCTTCTCTCTTTTCGATCAAAACGAGAAAGCTAACTAAAGAAACTAAACTATTTT
CTTAACTTCTCACACTCCTAAGTTCTTAAAATTAGTGGAAACCTCTTTAAAAACAACTAA
ACTCTCTCATAAAATATTATCATCTTTCATCAAAAAAATATTGAGAGTCGCTATGGTCCA
TCCTCCAAACATCCTTTTATGGGCTGTCTCATTAACCATCAACATTATAAAAAAGTAATC
AAATTCTATTCTATTTAGCTAAACTAAGTTTTTTTTAAATATTTGTTTAGGAACCCTACA
TTGGTTGCCATGCTTGATACTCAAGAATTGAAAGAGAAAATATAAGATTGCTTTATCCCT
GACTAAAAAGATTTAGATAATTGCTAGGCCTAAGAATCTTTCTTATGGGAATTAAAATCT
ATAAAAAACCATTACTTAAATGAAGTTGAAAAAATGGTTAAAGTCTTAGGTACAAAATTA
GACGTAGCCTAATTTATAGAATTAGAAAGCTTTACCGATGTACAATATGACCACTTTATC
CGCTTATATATAGATGCTGCTAAAAATAAAAAAGTTACTTTCCCTATAGAAAATAAAATC
GAAAACATTCAATAACTTTAACTAATCAACACAACTTTATTTGAATGA