Identifiers and Description

Gene Model Identifier

TTHERM_00191850

Standard Name

NOC3 (NucleOlar Complex associated 3)

Aliases

PreTt08835 | 15.m00546 | 3697.m00257

Description

Subunit of a nuclear complex with Noc2p

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF03914 ) CBF/Mak21 family
  • ( PF07540 ) Nucleolar complex-associated protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00191850

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_06142.19.997093137033517e-262hypothetical protein (633 aa)
WormBaseWBGene000165081.999981404597394e-31Nucleolar complex protein 3 ho
molog status:Partially_confi
rmed UniProt:P91136 protei
n_id:CCD66984.1
OxytrichaContig13994.0.g71.0002124404074584e-26CBF/Mak21 family
DictyBaseDDB_G02936224.999245259173412e-21DDB_G0293622 on chromosome: 6
position 3159608 to 3162709
SGDYLR002C0.00000000030007160092483236NOC3 Protein that forms a nucl
ear complex with Noc2p that bi
nds to 66S ribosomal precursor
s to mediate their intranuclea
r transport; also binds to chr
omatin to promote the associat
ion of DNA replication factors
and replication initiation

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00191850(coding)
ATGGGAAAAAATAAATAGGATAAACCTAGCAAGGAAGGTGAAACGAACAAATCTCTTTTT
CACAGTTTGTTGAAGAATGAAAGGTTAGTTATAGAAAAAAAGGAATTAAATAGCTTATCA
TTGATGCAACTCACTTAGCTCATAGAAGAGATTTCATAGGAAATAATAGCAAAACCAGAA
GCTAATATTATCCACATGCAAACATTATTCCATTTATTAGAGAAAGACAGTATACTAATA
GTTAAACTTAGTGCTTACTCTATTGTTGAAATTTTCAAAGATATCACTCCCTTATATAAG
ATAAACTTTAAGGAATCATAAGAAAAATTAGCTACTAAGATAACAAAAGAAGAACGTCAA
GTTATTTAGACTGAATGTAGAATTTATGAATTCTATGAAAAATATATCAAGCTTATGGCA
TACTTTGCTAAGTTAAAAAACAAGGAAGCAAAGAATTTAGGATAAGAAGTAAATGAAGAA
ACTAAATAATAATTCAATCAACTAAGAAGAATAGGCACTAAGTGCTTATTAGAGTTATTG
AAGCATCTTTATCATTTTAATTTTGCTAAAGAAATAGCTGAATTTGTTACCCATAAATTA
GTATCAGTTGATAAAAAAGTTAGAGATTCTGCTATTGAAATTATCACATCCATTTTATCA
GATCCTACTCACTCAATCTATGAAATTAAGGTTGTTATTCTAAATGAAATGGGAAAGATC
TTAAACACTACTACCGAAAAAGACTTACCAGATGATTTTATAGAAATTGTTGGTTGTGTA
GAAATAGATACTAAGTTTTTAAAAAAAGACTTCGATGAAGACAAACGTAAGAAGGCCATA
GAATACAAGAAGGCAAAGAGATAGTTTTATAAAGACAAGGAAAAAGAAAAAGGTAATGTA
AAGAATAGTAAAAAGAGAAAGCTTGAAAATGCTAAGGGTGAAAAAGATGATATAGATTAG
GTTAAATCAATGAAAGGTGTCGATAAAAACGAATTAAAAAAAATGAAAAAGGAATTAAGA
GAAGAACTTGAAGAATAAGATGCTGAAATAGATCCTAAATTGCTTATTAAATATAATGCT
TAAATCTTAGAAAAAGTATATTATATCTATTTCAAGCTCATTAAAAGACCTTCTCCAACC
AAGTTCTTTACTTCAGTTATGGATGGTATTGTTAAGTTTATTCACATGATTGATGTCAAT
TTAATTTGGGATTTAATTGGTTGTTTGCAAAAAAGTGCTTAAAACATGAGATAATACACA
AATAAAAAGGGAGGAGATGATAAAATGGCTTTGCATAAAAGAATGCATTGCATTTACACA
GTAGAAGCCATCTTAAATGGACCAGGTTAAGTCTTTGATGTTGATGATAAGGAAGCTATT
CTTAATTTCTTCCATGTCATGATTGATCTTAACAAGATCCCTCATGTTTTCGATCAGTTA
TCTTAAAAGGAAGAACTTGTGCTAATTAAGATTCTTGAAATTATGTTCTTAAAGAAGAGA
TAATTCTCCTATGAAAGTGTTGCAAGCTTTGTCAAAGAATTGGCTAAACTTGCTATTAAA
TTAAACGACAGAAAATAATTTTAATACACTGTTCTATTTGTCATAAAAATGCTATTTTCC
AAACATTCAAAGATTAACAGGATGCTTGATTCTGATAATGATGGATTTGGATTAAATAGA
TACAATGAAAGAATCGAGGATCCTCAATCAACCAATGCTATTAACACTTCAATTCACGAA
GAATTAACTAAGGTTTAGACATCACAAAATACTCCTGAAATAAAAAATATTTGCAAAAAG
ATTCTAGAATCTGCTCCTCTCCACCCATCTCTTTCTACTTTGAGCGTGTAGGATTTTTAT
AACAAACATAGTAACTTAAAATGA


>TTHERM_00191850(protein)
MGKNKQDKPSKEGETNKSLFHSLLKNERLVIEKKELNSLSLMQLTQLIEEISQEIIAKPE
ANIIHMQTLFHLLEKDSILIVKLSAYSIVEIFKDITPLYKINFKESQEKLATKITKEERQ
VIQTECRIYEFYEKYIKLMAYFAKLKNKEAKNLGQEVNEETKQQFNQLRRIGTKCLLELL
KHLYHFNFAKEIAEFVTHKLVSVDKKVRDSAIEIITSILSDPTHSIYEIKVVILNEMGKI
LNTTTEKDLPDDFIEIVGCVEIDTKFLKKDFDEDKRKKAIEYKKAKRQFYKDKEKEKGNV
KNSKKRKLENAKGEKDDIDQVKSMKGVDKNELKKMKKELREELEEQDAEIDPKLLIKYNA
QILEKVYYIYFKLIKRPSPTKFFTSVMDGIVKFIHMIDVNLIWDLIGCLQKSAQNMRQYT
NKKGGDDKMALHKRMHCIYTVEAILNGPGQVFDVDDKEAILNFFHVMIDLNKIPHVFDQL
SQKEELVLIKILEIMFLKKRQFSYESVASFVKELAKLAIKLNDRKQFQYTVLFVIKMLFS
KHSKINRMLDSDNDGFGLNRYNERIEDPQSTNAINTSIHEELTKVQTSQNTPEIKNICKK
ILESAPLHPSLSTLSVQDFYNKHSNLK


>TTHERM_00191850(gene)
ATGGGAAAAAATAAATAGGATAAACCTAGCAAGGAAGGTGAAACGAACAAATCTCTTTTT
CACAGTTTGTTGAAGAATGAAAGGTTAGTTATAGAAAAAAAGGAATTAAATAGCTTATCA
TTGATGCAACTCACTTAGCTCATAGAAGAGATTTCATAGGAAATAATAGCAAAACCAGAA
GCTAATGTAAATTATGATGAAGGATGAGGACACATAAACATTTTTAATTATAAATTAGAT
TATCCACATGCAAACATTATTCCATTTATTAGAGAAAGACAGTATACTAATAGTTAAACT
TAGTGCTTACTCTATTGTTGAAATTTTCAAAGATATCACTCCCTTGTAAATAAATATTCT
TATTTTAGCTTAAAATTTTGGATAGTAGAAACTAAACATTTATTTCAAAATATGATTAGA
TATAAGATAAACTTTAAGGAATCATAAGAAAAATTAGCTACTAAGATAACAAAAGAAGTA
AGACATTTCAGTTAAATTACTTATTTAATAAAAATAATTCTTTCTTTCTATTAAAAGGAA
CGTCAAGTTATTTAGACTGAATGTAGAATTTATGAATTCTATGAAAAATATATCAAGCTT
ATGGCATACTTTGCTAAGTTAAAAAACAAGGAAGCAAAGAATTTAGGATAAGAAGTAAAT
GAAGAAACTAAATAATAATTCAATCAACTAAGAAGAATAGGCACTAAGTGCTTATTAGAG
TTATTGAAGCATCTTTATCATTTTAATTTTGCTAAAGAAATAGCTGAATTTGTTACCCAT
AAATTAGTATCAGTTGATAAAAAAGTAATTAGAGAATTTATAGCATATTCTTAAATTTAT
CTAATTAATTATTTAGATTACTGCGAATATCCAAATATAATGTTTATTCTTAATATTTAG
GTTAGAGATTCTGCTATTGAAATTATCACATCCATTTTATCAGATCCTACTCACTCAATC
TGTAATATTATTTCATTTTAGTAGAAAATTTAGATTTATAGGCAACAAATTATAAAAATT
TAGATGAAATTAAGGTTGTTATTCTAAATGAAATGGGAAAGATCTTAAACACTACTACCG
AAAAAGACTTACCAGATGATTTTATAGAAATTGTTGGTTGTGTAGAAATAGATACTAAGT
TTTTAAAAAAAGACTTCGATGAAGACAAACGTAAGAAGGCCATAGAAGTAAATTGAATAA
TAAAGTAAGTCTGTTATTTTAAATTAAAATTAATTATAATAAATAGTACAAGAAGGCAAA
GAGATAGTTTTATAAAGACAAGGAAAAAGAAAAAGGTAATGTAAAGAATAGTAAAAAGAG
AAAGCTTGAAAATGCTAAGGGTGAAAAAGATGATATAGATTAGGTTAAATCAATGAAAGG
TGTCGATAAAAACGAATTAAAAAAAATGAAAAAGGAATTAAGAGAAGAACTTGAAGAATA
AGATGCTGAAATAGATCCTAAATTGCTTATTAAATATGTAAGATAGTTTAAATTTCTTCA
AAATAAATTTAATCTCATTGTTTTTTTTAATATAATAGAATGCTTAAATCTTAGAAAAAG
TATATTATATCTATTTCAAGCTCATTAAAAGACCTTCTCCAACCAAGTTCTTTACTTCAG
TTATGGATGGTATTGTTAAGTAGGGTTATACATTTAATTTTATTCAAATTTTGAAAATTT
ATATTTTAAAATAATAAGGTTTATTCACATGATTGATGTCAATTTAATTTGGGATTTAAT
TGGTTGTTTGCAAAAAAGTGCTTAAAACATGAGATAATACACAAATAAAAAGGGAGGAGA
TGATAAAATGGCTTTGCATAAAAGAATGCATTGCATTTACACAGTAGAAGCCATCTTAAA
TGGACCAGGTTAAGTCTTTGATGTTGATGATAAGGAAGCTATTCTTAATTTCTTCCATGT
CATGATTGATCTTAACAAGATCCCTCATGTTTTCGATCAGTTATCTTAAAAGGAAGAACT
TGTGCTAATTAAGATTCTTGAAATTATGTTCTTAAAGAAGAGATAATTCTCCTATGAAAG
TGTTGCAAGCTTTGTCAAAGAATTGGCTAAACTTGCTATTAAATTAAACGACAGAAAATA
ATTTTAATACACTGTTCTATTTGTCATAAAAATGCTATTTTCCGTAATAAAATCTTAATT
AATTAATTAATTTTTAAAATTATTTTACTAAAATAAATTTTATAAAACTAGAAACATTCA
AAGATTAACAGGATGCTTGATTCTGATAATGATGGATTTGGATTAAATAGATACAATGAA
AGAATCGAGGATCCTCAATCAACCAATGCTATTAACACTTCAATTCACGAAGAATTAACT
AAGGTTTAGGTAAATCTTTATACAACTTGAATTAATTGGATATGATTAAATTAAGGATTT
TGGCTGGATACTTGAACAGAAAAAAAAACCAATTATAATTATTATTAAAAAAGACTAAGG
CCTATTTGTAATCAATCAATAAATCAGCCAACCAACCATATTCCATTTTATTCACAATAA
AAAATAAAATATAAAATCATAATCATTTTTATTATATTTATGAAACATTTTTTAATATAT
TTTTTATCAATAGACATCACAAAATACTCCTGAAATAAAAAATATTTGCAAAAAGATTCT
AGAATCTGCTCCTCTCCACCCATCTCTTTCTACTTTGAGCGTGTAGGATTTTTATAACAA
ACATAGTAACTTAAAATGA