Identifiers and Description

Gene Model Identifier

TTHERM_01220330

Standard Name

NOC2 (Nucleolar Complex Protein 2)

Aliases

PreTt17297 | 279.m00022

Description

Protein involved in ribosome biogenesis

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_01220330

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17176.19.997093137033517e-262hypothetical protein (681 aa)
SGDYOR206W9.999142814001536e-47NOC2 Protein that forms a nucl
eolar complex with Mak21p that
binds to 90S and 66S pre-ribo
somes, as well as a nuclear co
mplex with Noc3p that binds to
66S pre-ribosomes; both compl
exes mediate intranuclear tran
sport of ribosomal precursors
DictyBaseDDB_G02843834.997755005759707e-41DDB_G0284383 on chromosome: 4
position 1920700 to 1923303
WormBaseWBGene000074131.0003081162615753e-33locus:pro-2 Nucleolar comple
x protein 2 homolog status:C
onfirmed UniProt:O17580 pr
otein_id:CAA90103.2
OxytrichaContig9986.0.1.g813.001290106883431e-24Noc2p family
Stentor CoeruleusSteCoe_149330.0000000000006914400106940203

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01220330(coding)
ATGGTAGCTAGCAAGGTCATTTCGTTAAAGCGTGTAGAAGACATTATTCAGAAAGTAGAA
AAGGAGCCTACTTAAAAATCAATAGCTCACTTTATCAAAATTTTCCGTATTTGCGTCTCT
CAGAATGAAGATGAAAATGTAGATGAACTCGAAGAGAATAAAAATGAATAGGACTTTATC
ATTGAAGATGGAGCCGTTTATGACAAGGTTGTTACTTTTGCATTACAGAGATTCCCCTAT
CTTCTTAAGAAGTTATTAAAACTCGAAGATGGTTAAATTTTAGAATCAGTTTCTTCTAGA
AAGTTAGATATTGTGCTTAAAGTCTACCTTCTTAACATAGTCAAAATGGCTGAAAATGTT
CATGACGAAGACATGTTAATTTACATGCTCACATTTTACCCAATTATTACAGACTTCATG
TTCCCTTTAAAGAAACTTTTTATGAGATTTTTAAAGTACATGGTTGAATTGTGGGCAACC
AACAACAACTTAAAGTTGAAGTTGAAGGCTTTCATCGTCATAAGAAGAATATGTAAAAAT
ACCAAGAGTGAAGAAGTCGATAAGATTTTCAGAAGAGTCTATGCTGCTTATTTTGAAAAT
GTTAGACACGTATCTTGGAGAACTTATGAATCTGTTATCTTTATGATCAACTGTTATACT
GAATTGATGATGGAACATAAAGACGCTGCTTACTACATTGGTTTCTCATATTTAAGATAA
ATTGCAGTCCTTCTCAAAGATAACATGGCAAAAAAGGGAGATGAAATGAAAGTGTTTAAT
TGGTAAGTAATTAACTCACTAAAGCTCTGGAGTTAGACTATTAGCAGATAACCTGCTGAT
GAAGATTTAGGATAATTGCTCTATCCTTTAGTTGAACTTATTATTGGTGTAAACTAATTC
AGTAACTCTCAAGAATACGTCCCATTGAAGTTCCACTTGATTCAATGCTTAAATTCTATC
GCTTAGAAGACTGACACTTTTATTCCTACTTTGAAATTGATCAAGGATGTTCTCAACTCT
GGTGAATTCAGAAAAAAGAAAACCCAATCTACTAAAAAACCTTTTGATTTTAGCATTAGC
TTGAAGATTGATAATAAATATAAAAATACTAACGTTTTATGGAATGAAATATTCAAGTTT
GGTCTTGATCTTTCTGCTGAATATTTAGCTATTTACAGCAGAGATATTGGTTTCCCTGAA
ATGTGCTACAATTATATTAAGTATTTAAAAAAGCTTTCAGATTCTGTTTAGTTTGTAGTT
TATAAAATGCAAATTAAGGAACTCATGAAGACTATCAGAGCTAGTGTTGATCTTGTTCTC
AGCAAGCGTAAAGGTGTCAATTTTGCTCCTAAAAACATTGAACAAGATGCTAAATTCTCA
GAAGATAATTTCAAAGATGTTAAGGAAACTCCCTTGGAATAATTAAGAAATAAAATTGTC
AGTGAAAGAGAAACTAGAATTAAGTAAAGAATTTTGGCTGAAAAGGATTAGAATTACGAT
GAAGGTGATGATGGAGAAGATGAAGCTGCAGGTGATGAAGAAGACGAAGATATGAGTGGA
GATGAAAGTGGAGACGATGGTACTGATAAGAAGAAAAAGAAAATCAAAAAAGATTTAGAT
ATCGCTGATGAGAGTGACAGTGACGCTTTCGATCCTGAAAATTACAAGGACTCTGATGAA
GAAGACAATAAAGAAGATGATGAAGAAGAATACGATTTTGAAAACATGGATTATGAAGGT
GATCCTGATGATTTACCTGACTTCGATTTGATTGATGAAGTAGACGACAATAATGATGAT
AATTAATTATCTGAAGATGATTTCGATAACGAAGATGAAGAAAATGAAGAAGGAGAAGGT
GAAGAAGAATAAGAAGAGGAAGTTGAAGAAAAATAAGATAATTTTAAAAAATCTAAAAAG
GGTGACTAAAAATCACAATAATTCTAACATGGCAATAAGAAAAAACAAATTACTAAAAAT
AGAAACAAAAACAATAAATTCAGCAGAGGAGGAAAGAATTAAAAGAATTTCAGAAATAAT
AAGAAATAAAATTTTGGAAAGAGAAGAAAGTGA


>TTHERM_01220330(protein)
MVASKVISLKRVEDIIQKVEKEPTQKSIAHFIKIFRICVSQNEDENVDELEENKNEQDFI
IEDGAVYDKVVTFALQRFPYLLKKLLKLEDGQILESVSSRKLDIVLKVYLLNIVKMAENV
HDEDMLIYMLTFYPIITDFMFPLKKLFMRFLKYMVELWATNNNLKLKLKAFIVIRRICKN
TKSEEVDKIFRRVYAAYFENVRHVSWRTYESVIFMINCYTELMMEHKDAAYYIGFSYLRQ
IAVLLKDNMAKKGDEMKVFNWQVINSLKLWSQTISRQPADEDLGQLLYPLVELIIGVNQF
SNSQEYVPLKFHLIQCLNSIAQKTDTFIPTLKLIKDVLNSGEFRKKKTQSTKKPFDFSIS
LKIDNKYKNTNVLWNEIFKFGLDLSAEYLAIYSRDIGFPEMCYNYIKYLKKLSDSVQFVV
YKMQIKELMKTIRASVDLVLSKRKGVNFAPKNIEQDAKFSEDNFKDVKETPLEQLRNKIV
SERETRIKQRILAEKDQNYDEGDDGEDEAAGDEEDEDMSGDESGDDGTDKKKKKIKKDLD
IADESDSDAFDPENYKDSDEEDNKEDDEEEYDFENMDYEGDPDDLPDFDLIDEVDDNNDD
NQLSEDDFDNEDEENEEGEGEEEQEEEVEEKQDNFKKSKKGDQKSQQFQHGNKKKQITKN
RNKNNKFSRGGKNQKNFRNNKKQNFGKRRK


>TTHERM_01220330(gene)
ATGGTAGCTAGCAAGGTCATTTCGTTAAAGCGTGTAGAAGACATTATTCAGAAAGTAGAA
AAGGAGCCTACTTAAAAATCAATAGCTCACTTTATCAAAATTTTCCGTATTTGCGTCTCT
CAGAATGAAGATGAAAATGTAGATGAACTCGAAGAGAATAAAAATGAATAGGACTTTATC
ATTGAAGATGGAGCCGTTTATGACAAGGTTGTTACTTTTGCATTACAGAGATTCCCCTAT
CTTCTTAAGAAGTTATTAAAACTCGAAGATGGTTAAATTTTAGAATCAGTTTCTTCTAGA
AAGTTAGATATTGTGCTTAAAGTCTACCTTCTTAACATAGTCAAAATGGCTGAAAATGTT
CATGACGAAGACATGTTAATTTACATGCTCACATTTTACCCAATTATTACAGACTTCATG
TTCCCTTTAAAGGTAAAGCAATAAATAATTAATTATAATTTCAACAGACAATTAATGTTT
TTTCTCAATAATAGAAACTTTTTATGAGATTTTTAAAGTACATGGTTGAATTGTGGGCAA
CCAACAACAACTTAAAGTTGAAGTTGAAGGCTTTCATCGTCATAAGAAGAATATGTAAAA
ATACCAAGAGTGAAGAAGTCGATAAGATTTTCAGAGTAACAAAAAACATTTTTGCAATAA
ATCAAATAAAATTATAATTTCTATCTATTTAATATAAAGAGAGTCTATGCTGCTTATTTT
GAAAATGTTAGACACGTATCTTGGAGAACTTATGAATCTGTTATCTTTATGATCAACTGT
TATGTAATTATAAAAAATATATAAATAAATGTATTACATTCTATAAAATACTATTTTTTT
TAATAGACTGAATTGATGATGGAACATAAAGACGCTGCTTACTACATTGGTTTCTCATAT
TTAAGATAAATTGCAGTCCTTCTCAAAGATAACATGGCAAAAAAGGTGAGTTTTTACAAT
ACTTCAGCAGCATAATTATTTGATATGATTTTAAATACGATAATTGGGTAATTCCCAATA
ACTAACTAAACAGCAGATAGATATTTAAAATTTTAGTTTAAAAATAAATAACAGATAGAT
ATTAAGAATTTAGTTGTTATTTAACTAAAATAATTGGTTGTTTTATTTAGAATAAAATTA
AATACAGTAACATTTTATTAAATACTTTAATAGTTGCGAATAGCTTTGATTGCTGAGAAT
ATAAATTAAATAATAAAACCAAAATACAATAGGGATTCTTTCAAATAAGCATTAATTATA
TACAATCCATAGTTTTTTTTAATTCAATAAAAAATATTTGGTATTTTTAAAGAGTTAAAG
TAAATGTTAATAAAAAGTTAAATTCTTATTTTTATTAAAATGATTATCTTATCAAATCAA
ATGTTGCTGCTTTATAAAGAATATATTCTAAATTTTTAAATTTGAAATTAAAGGGAGATG
AAATGAAAGTGTTTAATTGGTAAGTAATTAACTCACTAAAGCTCTGGAGTTAGACTATTA
GCAGATAACCTGCTGATGAAGATTTAGGATAATTGCTCTATCCTTTAGTTGAACTTATTA
TTGGTGTAAACTAATTCAGTAACTCTCAAGAATACGTCCCATTGAAGTTCCACTTGATTC
AGTAAATAAAAATATTTTAAATAAAATTAATTTAATTTATTTATTTATTTATTATGAAGA
TGCTTAAATTCTATCGCTTAGAAGACTGACACTTTTATTCCTACTTTGAAATTGATCAAG
GATGTTCTCAACTCTGGTGAATTCAGAAAAAAGAAAACCCAATCTACTAAAAAACCTTTT
GATTTTAGCATTAGCTTGAAGATTGATAATAAATATAAAAATACTAACGTTTTATGGAAT
GAAATATTCAAGTTTGGTCTTGATCTTTCTGCTGAATATTTAGCTATTTACAGCAGAGAT
ATTGGTTTCCCTGAAATGTGCTACAATTATATTAAGTATTTAAAAAAGCTTTCAGATTCT
GTTTAGTTTGTAGTTTATAAAATGCAAATTAAGGAACTCATGAAGACTATCAGAGCTAGT
GTTGATCTTGTTCTCAGCAAGCGTAAAGGTGTCAATTTTGCTCCTAAAAACATTGAACAA
GATGCTAAATTCTCAGGTAAATTTAATTTATTTTTGTTAACATATTTGTAAGTTCGATAA
TAAATAATGTAGAAGATAATTTCAAAGATGTTAAGGAAACTCCCTTGGAATAATTAAGAA
ATAAAATTGTCAGTGAAAGAGAAACTAGAATTAAGTAAAGAATTTTGGCTGAAAAGGATT
AGAATTACGATGAAGGTGATGATGGAGAAGATGAAGCTGCAGGTGATGAAGAAGACGAAG
ATATGAGTGGAGATGAAAGTGGAGACGATGGTACTGATAAGAAGAAAAAGAAAATCAAAA
AAGATTTAGATATCGCTGATGAGAGTGACAGTGACGCTTTCGATCCTGAAAATTACAAGG
ACTCTGATGAAGAAGACAATAAAGAAGATGATGAAGAAGAATACGATTTTGAAAACATGG
ATTATGAAGGTGATCCTGATGATTTACCTGACTTCGATTTGATTGATGAAGTAGACGACA
ATAATGATGATAATTAATTATCTGAAGATGATTTCGATAACGAAGATGAAGAAAATGAAG
AAGGAGAAGGTGAAGAAGAATAAGAAGAGGAAGTTGAAGAAAAATAAGATAATTTTAAAA
AATCTAAAAAGGGTGACTAAAAATCACAATAATTCTAACATGGCAATAAGAAAAAACAAA
TTACTAAAAATAGAAACAAAAACAATAAATTCAGCAGAGGAGGAAAGAATTAAAAGAATT
TCAGAAATAATAAGAAATAAAATTTTGGAAAGAGAAGAAAGTGA