Identifiers and Description

Gene Model Identifier

TTHERM_00976490

Standard Name

NOC1 (NucleOlar Complex associated )

Aliases

PreTt21735 | 182.m00045

Description

Constituent of 66S pre-ribosomal particles

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF02985 ) HEAT repeat
  • ( PF03914 ) CBF/Mak21 family
  • ( PF05535 ) Chromadorea ALT protein
  • ( PF05316 ) Mitochondrial ribosomal protein (VAR1)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.6%

TetraMine Data

TTHERM_00976490

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13924.19.997093137033517e-262hypothetical protein (930 aa)
OxytrichaContig18894.0.g354.001968334034435e-68CBF/Mak21 family
SGDYDR060W2.0002571866765887e-62MAK21 Constituent of 66S pre-r
ibosomal particles, required f
or large (60S) ribosomal subun
it biogenesis; involved in nuc
lear export of pre-ribosomes;
required for maintenance of ds
RNA virus; homolog of human CA
ATT-binding protein
WormBaseWBGene000090841.0000844672813518e-48Uncharacterized protein F23B12
.7 status:Confirmed UniPro
t:Q19753 protein_id:CAB01168
.1
DictyBaseDDB_G02792053.998097515166115e-39DDB_G0279205 on chromosome: 3
position 1747299 to 1751183
Stentor CoeruleusSteCoe_203474.4737793061811207e-38

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00976490(coding)
ATGGCAAGGTTCAATAAATTCAAACCTTAACAAACTAACTAAGATAAAAAGGACAATAAA
AATGGTAGCTAAAACTAGAAAGGACAAAATGCCAACCATTAAAATAAAGTTGAAAACAAA
ACTAACAAGAATAGCGTTTAGAATTAGGTTAATGATTAAGATGAAAATATCAATGCAGGT
GAAAACTGGAAAAAGGCTCAATAATTCAAGAATGAGACAATATTCGAAAGAGCATCCAGA
GTTTACTAAGAATTTGTCAAAAAGGAATTGTAGAAGTATAAATTAGCTAAAGCTGATGAG
GCTTGGATGAAAAAAATCATGACTGATGGTACTTTAAAGGATAAAATTTCAGCCATTTCC
ATTTATATTAGAGATAACCCAAAAACAACTTTGCCTGCTATAGAAAACTTAATGACTTTT
GCTAATACAAAGAGTAAAAAAGACATTATTTTAAGCTACAATGCACTTAAAGGCATCTTT
TTGGAGTCTGTTATGCCAAAGAATGCTGAATTAAAAACATTTTAGCAAAATACAAAGGGA
AAAACCAATATTTCTGATAAAGATCTTGTTGAGTACTTCTATCAACATAAGTTAAAAGAA
ATATTTTACAGATATGTGAATAGCTTGATAGCACAGTTAAATGATAATTTATTCTTTTTC
AGAAAGGCTATGTTGATGCTTTTATTAGATGTTGTTATGCATAGACAAGAATGTCAAGAA
ACTATTTTAGGTGCTCTTCTCAATAAGCTTGGTGACTCAGACAAAAAGATAGTCACTATC
CTTAACTAAAACTTAGGAAAATTATTATTTAGAAAAGGAGAACTTGTTATGCCACTAGTT
AAAGAAATTGAAAGATTTGTTTTCAGACCAAACATTAAAATATAGAGCTAATTTTATGCA
ATCAACTTCTTGAATACCATCAATTTTGCTGTTGTTGCAGATGATGTTTTGAAGGAGATT
ATTAAGCTTCTATTTATCTTATTCAAGAAAATGATTGAAACCAATGAAGAAGATTTGCTT
GCATCAAAAATATTAAGTTAGATCTTAAGAGGTATCAACAAAATATTCCCTCATACAAAG
AAAAATTTCGAATAATACAAACAATTCTTTAATGAGAAAATAAATGAATTATACAAGCTT
ATTCACTAAACTAAGAGCATTAAAATTAGAATTTAAACTTTGCTATTCATCTTTTAAGTT
GAAAACTAAGAAAATAATCTAACTGATAGATATTATCGTGTTTTATATGAAATGTTAATT
GACCCTGATGTTACTCACTCTTCTCAAACTGAACTTTTCTTTGATCTTTTATATTTCTCT
TTAAAAGCTGACTTAGATATTGGAAGAGTTAAGAGTTTTGTTAAAAGATTGTTGCAACAT
GCAATCCATTGTGAACCTCCTTTCATTATTACTTCTCTCATTTTCATCTCTAAATTGTTA
AACGCTCAACCTACCATAAAGACCATGATCTAACAAAGTGAACGTTTCTTTGATGATAAT
GAAGAAAATTTCAAAGATGTTGAAGATTCTGATGAAGAAGAAAATTTCAAAGACGCTGAT
GAATCTAAAAGCATGGAAGTAGAAGAAGCAAATAATTAAGAATAGTAAGAAAATGAAAAT
GGTGATGAATAAGAAAAAGAAATCACAAAAAAAGAGTAAAAAAAGAATTATGCTGATTAT
ATGGGCTATGATGCTTTCAAGAGAGAACCTCGTTTCACAGGCTGCAACGAATCTTGCTTG
TGGGAATTAACAGTTCTTATAAATCACAATCACCCAACTGTCAAAAAATTCACAGAAATT
CTTCTTAGTTAATAAAAACCCAACATTGAGTACAAAGGAAATCCTTTACTTGATTTTACA
GTTGCAAACTTTTTGGATCGTTTTTCTTTCAAGAATGCTAAAAAGAAAGAATCTGTTGGT
ATGAAGAATTTAAAATAAAAAGGAAAGATTAGAATGTCTAAATTAGAATCTGCTTTATAA
GTTGATGATGTTATGAAAATGGATTAAAGAAAGATTAGAGAAGAAGAAAAATTCTTTTTG
AGATTCTTCTAACAAAAGTAGAAAAAGAGAGAAGGAATAGAAAAGAGATAAAAGAAGAGA
GATATGGAAGATTTTGTTGACGGAAATGATGATGCTGAAATGGACGCTTTTGCTGATTAG
CTTGCTGAAGAATAGCTTGACAGTGATTTCTATGATGAAGATGAACCTTTCTCAATGTCT
GAAGATCAAGATGAAGATGATGGAGATATGGAAGATGGTGAAGGAGATGAGTATCACGAT
TTCGATGAAGAAGAAGACGGGGAAGATTAAGAAAATGAAGATTTCAACGAAGATGAAGAA
TAAGAAGATGATGAAGACATCGAATAAGATTTCGATGAAAATGAAGAGTTATAATCTGCT
GAAATTCCTGATAATTATGAGGACTCTGAAGAAGATGAAGAGGAGCAATTAGAAGGCGCT
GATGAAGAAGAAGAGGACGATTTTGATGAAGACGATTTAGGTGATATTGAAGATTTAGAA
TAAGATTTCGAGTAAGACAGAGAGAAAATGGGATTAGAAGAGAGCGATTATGAAGATGAT
GATATTGAAGACTTCGGTACTTTATTAGAGAAAGCAGGTCAAGAAGACGATATTGATGAT
AGAAAAAAATTTGGAAAACAAATAGGATAAAAAGTAAGCAAAACAAAAGTAATTAAAAAA
GAACCAAAGGCAGAGAAAAAACCAAGACATTCTAAAGTAGATAAAAAGTAGAACAAAAAG
GGACCTAAGAAAGTAAAAAAATAAAATAAAGGAGGAGCTAAAAAAAATAAAAAGGGAAAA
GGAAGAAAATGA


>TTHERM_00976490(protein)
MARFNKFKPQQTNQDKKDNKNGSQNQKGQNANHQNKVENKTNKNSVQNQVNDQDENINAG
ENWKKAQQFKNETIFERASRVYQEFVKKELQKYKLAKADEAWMKKIMTDGTLKDKISAIS
IYIRDNPKTTLPAIENLMTFANTKSKKDIILSYNALKGIFLESVMPKNAELKTFQQNTKG
KTNISDKDLVEYFYQHKLKEIFYRYVNSLIAQLNDNLFFFRKAMLMLLLDVVMHRQECQE
TILGALLNKLGDSDKKIVTILNQNLGKLLFRKGELVMPLVKEIERFVFRPNIKIQSQFYA
INFLNTINFAVVADDVLKEIIKLLFILFKKMIETNEEDLLASKILSQILRGINKIFPHTK
KNFEQYKQFFNEKINELYKLIHQTKSIKIRIQTLLFIFQVENQENNLTDRYYRVLYEMLI
DPDVTHSSQTELFFDLLYFSLKADLDIGRVKSFVKRLLQHAIHCEPPFIITSLIFISKLL
NAQPTIKTMIQQSERFFDDNEENFKDVEDSDEEENFKDADESKSMEVEEANNQEQQENEN
GDEQEKEITKKEQKKNYADYMGYDAFKREPRFTGCNESCLWELTVLINHNHPTVKKFTEI
LLSQQKPNIEYKGNPLLDFTVANFLDRFSFKNAKKKESVGMKNLKQKGKIRMSKLESALQ
VDDVMKMDQRKIREEEKFFLRFFQQKQKKREGIEKRQKKRDMEDFVDGNDDAEMDAFADQ
LAEEQLDSDFYDEDEPFSMSEDQDEDDGDMEDGEGDEYHDFDEEEDGEDQENEDFNEDEE
QEDDEDIEQDFDENEELQSAEIPDNYEDSEEDEEEQLEGADEEEEDDFDEDDLGDIEDLE
QDFEQDREKMGLEESDYEDDDIEDFGTLLEKAGQEDDIDDRKKFGKQIGQKVSKTKVIKK
EPKAEKKPRHSKVDKKQNKKGPKKVKKQNKGGAKKNKKGKGRK


>TTHERM_00976490(gene)
ATGGCAAGGTTCAATAAATTCAAACCTTAACAAACTAACTAAGATAAAAAGGACAATAAA
AATGGTAGCTAAAACTAGAAAGGACAAAATGCCAACCATTAAAATAAAGTTGAAAACAAA
ACTAACAAGAATAGCGTTTAGAATTAGGTTAATGATTAAGATGAAAATATCAATGCAGGT
GAAAACTGGAAAAAGGCTCAATAATTCAAGAATGAGACAATATTCGAAAGAGCATCCAGA
GTTTACTAAGAATTTGTAACATTCAACATTTAAAATAATTCAATGAAAATGCTATAATTC
GATAATTTTTTACAAAAAAGGTCAAAAAGGAATTGTAGAAGTATAAATTAGCTAAAGCTG
ATGAGGCTTGGATGAAAAAAATCATGACTGATGGTACTTTAAAGGATAAAATTTCAGCCA
TTTCCATTTATATTAGAGATAACCCAAAAACAACTTTGCCTGCTATAGAAAACTTAATGA
CTTTTGTAAACTTTCTTTTAAGATAAATAGAAAATGATGACGTTTTAATTTTAATTATAG
GCTAATACAAAGAGTAAAAAAGACATTATTTTAAGCTACAATGCACTTAAAGGCATCTTT
TTGGAGTCTGTTATGCCAAAGAATGCTGAATTAAAAACATTTTAGCAAAATACAAAGGGA
AAAACCAATATTTCTGATAAAGATCTTGTTGAGTACTTCTATCAACATAAGTTAAAAGAA
ATATTTTACAGATATGTGAATAGCTTGATAGCACAGTTAAATGATAATTTATTCTTTTTC
AGAAAGGCTATGTTGATGCTTTTATTAGATGTTGTTATGCATAGACAAGAATGTCAAGAA
GTAAATAAATTTTAGCATAATTGTTAAATAAAATATTTAACTAATTTTGTAATTTTCTTA
ACAAAAGACTATTTTAGGTGCTCTTCTCAATAAGCTTGGTGACTCAGACAAAAAGATAGT
CACTATCCTTAACTAAAACTTAGGAAAATTATTATTTGTAAAATTAATTTAAAGTAAAAG
TTTACTAAGCATCAATATATTTTAAATTAAAGAGAAAAGGAGAACTTGTTATGCCACTAG
TTAAAGAAATTGAAAGATTTGTTTTCAGACCAAACATTAAAATATAGAGCTAATTTTATG
CAATCAACTTCTTGAATACCATCAATTTTGCTGTTGTTGTAATAAATTAATTCCATTTTT
TTATATCATTTTTCATTTATTTATCTTTCATTTGCTATTTGTTTTGATAATAAAAGCTTA
AAATATAAAAAACAAACTTGATGAATTAATTTTTAATTTTATAATTAAAATCCAAAAAAT
TCATTTATAAATGGTTGAATTTTAAAGATTTTTTGATTGATTGATTGATAAATGATTTAT
TATTTTAAGTGAAAAATGATTTTTAAATAAAAATCAATAATTGCATTTGGCTTGATAGAG
ATTTAATTTTTATGTATTTGAATATAGGCAGATGATGTTTTGAAGGAGATTATTAAGCTT
CTATTTATCTTATTCAAGAAAATGATTGAAACCAATGAAGAAGATTTGCTTGCATCAAAA
ATATTAAGTTAGATCTTAAGAGGTATCAACAAAATATTCCCTCATACAAAGAAAAATGTA
ACGAATAATTTAAATAAAATGAATATTTAATTTTAATCTTTCTTTTTTGTTAAAATAAAT
AAATAAAGTTCGAATAATACAAACAATTCTTTAATGAGAAAATAAATGAATTATACAAGC
TTATTCACTAAACTAAGAGCATTAAAATTAGAATTTAAACTTTGCTATTCATCTTTTAAG
TTGAAAACTAAGAAAATAATCTAACTGATAGATATTATCGTGTTTTATATGAAATGTTAA
TTGACCCTGATGTTACTCACTCTTCTCAAACTGAACTTTTCTTTGATCTTTTATATTTCT
CTTTAAAAGCTGACTTAGATATTGGAAGAGTTAAGAGTTTTGTTAAAAGATTGTTGCAAG
TAAATTTATATTTTAAAATTCATCTAAATAAACAAACAAACTAATTTTTATTTTTATCAA
GCATGCAATCCATTGTGAACCTCCTTTCATTATTACTTCTCTCATTTTCATCTCTAAATT
GTTAAACGCTCAACCTACCATAAAGACCATGATCTAACAAAGTGAACGTTTCTTTGATGA
TAATGAAGAAAATTTCAAAGATGTTGAAGATTCTGATGAAGAAGAAAATTTCAAAGACGC
TGATGAATCTAAAAGCATGGAAGTAGAAGAAGCAAATAATTAAGAATAGTAAGAAAATGA
AAATGGTGATGAATAAGAAAAAGAAATCACAAAAAAAGAGTAAAAAAAGAATTATGCTGA
TTATATGGGCTATGATGCTTTCAAGAGAGAACCTCGTTTCACAGGCTGCAACGAATCTTG
CTTGTGGGAATTAACAGTTCTTATAAATCACAATCACCCAACTGTCAAAAAATTCACAGA
AATTCTTCTTAGTTAATAAAAACCCAACATTGAGTACAAAGGAAATCCTTTACTTGATTT
TACAGTTGCAAACTTTTTGGATCGTTTTTCTTTCAAGAATGCTAAAAAGAAAGAATCTGT
TGGTATGAAGAATTTAAAATAAAAAGGAAAGATTAGAATGTCTAAATTAGAATCTGCTTT
ATAAGTTGATGATGTAAATAATTTATTTATAATTTATTATTTCATTTTAAAAATATTTTA
TTTTTTTTCATTATTTTTGTTTGCATTTCTAAATAATTTTTTCATCTAAATAAAATATTT
TTAAAAATAATTTAGGTTATGAAAATGGATTAAAGAAAGATTAGAGAAGAAGAAAAATTC
TTTTTGAGATTCTTCTAACAAAAGTAGAAAAAGAGAGAAGGAATAGAAAAGAGATAAAAG
AAGAGAGATATGGAAGATTTTGTTGACGGAAATGATGATGCTGAAATGGACGCTTTTGCT
GATTAGCTTGCTGAAGAATAGCTTGACAGTGATTTCTATGATGAAGATGAACCTTTCTCA
ATGTCTGAAGATCAAGATGAAGATGATGGAGATATGGAAGATGGTGAAGGAGATGAGTAT
CACGATTTCGATGAAGAAGAAGACGGGGAAGATTAAGAAAATGAAGATTTCAACGAAGAT
GAAGAATAAGAAGATGATGAAGACATCGAATAAGATTTCGATGAAAATGAAGAGTTATAA
TCTGCTGAAATTCCTGATAATTATGAGGACTCTGAAGAAGATGAAGAGGAGCAATTAGAA
GGCGCTGATGAAGAAGAAGAGGACGATTTTGATGAAGACGATTTAGGTAAAATAAATACT
TTAAAATAATTATTGATTGTTTAATATTTTGAAATAAAAAATACAGGTGATATTGAAGAT
TTAGAATAAGATTTCGAGTAAGACAGAGAGAAAATGGGATTAGAAGAGAGCGATTATGAA
GATGATGATATTGAAGACTTCGGTACTTTATTAGAGAAAGCAGGTCAAGAAGACGATATT
GATGATAGAAAAAAATTTGGAAAACAAATAGGATAAAAAGTAAGCAAAACAAAAGTAATT
AAAAAAGAACCAAAGGCAGAGAAAAAACCAAGACATTCTAAAGTAGATAAAAAGTAGAAC
AAAAAGGGACCTAAGAAAGTAAAAAAATAAAATAAAGGAGGAGCTAAAAAAAATAAAAAG
GGAAAAGGAAGAAAATGA