Identifiers and Description

Gene Model Identifier

TTHERM_00222270

Standard Name

NMP1 (New Macronuclear PHD finger protein 1)

Aliases

PreTt12434 | 19.m00226

Description

PHD-finger family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.6%

TetraMine Data

TTHERM_00222270

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05554.29.997093137033517e-262PHD-finger family protein (100
3 aa)
OxytrichaContig17769.0.g1022.9990874792167046e-33PHD-zinc-finger like domain
WormBaseWBGene000069754.0002685161515803e-16locus:zfp-1 Uncharacterized
protein F54F2.2, isoform a s
tatus:Confirmed UniProt:P344
47 protein_id:CCD71235.1
SGDYPR031W0.000000000000006999063783600386NTO1 Subunit of the NuA3 histo
ne acetyltransferase complex t
hat acetylates histone H3; con
tains PHD finger domain that i
nteracts with methylated histo
ne H3

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00222270(coding)
ATGAGCGTTTTAAATCCAACATAAGAACAATTATCAGTGCTAAAAGAGCATTATAAGGAT
ATTATTTTGAACTGGCCTGAAGGTTACGATTTCTGCGAAGTTTGTCTAATTAAAGAAGGA
ATGCAACAAGATGATCTAATTTTTTGTGAACTCTGTAATGGCCTTGTTCACTAAAGTTGT
TACGGAGGAGAACTGCTTGATAGCATTCCAGAAAATGATTGGTATTGTGAAAGATGCAGA
GAGTACATCAGAGATTATATGAACGAGTAGAAATTGCACGACTTGTCTAGCATTAGATGC
TACTTTTGCCCTGAATAAAAAGGAATAGTCAAAAAAGTCACTATTCAACATTCAGGAACG
TAAATATGGTCGCATGTTGGTTGCGTTTCTTCAATAAAATCTTTGAACTTTGTTGACAGT
ACAAGAAATCTCATAGTTTAGAAATACAGTCCTAAGAGGACAACTGATGAATGCAAGATA
TGTGGGCTAAAGACAGGAAATTGCGGCTATTGCCATACTTCTGGATGCAATTTCACTTTC
CACTTTTCGTGTGGGAAAAGGATAGGAATCATACAAGATGTAATTACCATGAACACGTTA
ATGGAATGCAGAGAGAAATAGTACAAAAATTCTGAACCAGAGCATCATGTTGTCTTTTGC
GAAGAACATCTCTATAATTTAAGCTATGTCGAATATCCTAATGACAAATTTCTCAAAGAA
TTCATTTAGAATATGTACATTTAAAGAGAGACATTTGAAAATGAAGGAGATAATTTGAGT
GTGTTGATAGCAAATCAGTAAAAATGTGATAAAATTGAATACAACAAAAGCTAGCTTTAA
GAGAAATATATATAGAAAAAATAATAGCTACGTAAAAGTAAGAAAACAAGCTCTAACTCT
TTGCCACAATCAAAGCAAAATATCAGAGATAAAAGTAGAAGTAGAAGTAGAAGTCGCTCT
CCTCCAAAAAGCGATAGGAAAATTGCAGGGGGTAAAAAGCCTAAAAGTTCTGAATCCCAA
TTAGAAATTAGTGAAAAGGAGATCGGAGCATCAAAAAAACCTGCTTAAAAATCTAAGGCG
GCTTAATCATAATCGTAGACTGGCTCCAAAGCTCCTTCTAAGGGTAAGAAAGAAGAAGAA
AATAAAAGCTAACAATCCAATCCAACTTAAGCTGGAAAATCTAAAGGTGGCATTTCATCT
TCATAGTCACTCTCTCAAAATGACAAAGCAAACAAATCTAAGGTAGCAGCAACAACAGCA
GCAGTTTCTTTGTAGCCATAAAATTAACAAACCTCATCTAAAAACGACTAAAATAGTTAA
TCTGGTTTAAGCTAAACAAAAAAACAAACAAAAAAGGGTAAAAACGATGACGAACAAAGC
AATTAGCTTATTGAAAATTAAGATAATTGGAGGAGAATACAAAATGTTATGTAGAAGTAT
GATTATAGGGAAAAATAATTTAATAATAATAGTAACAATAACTCAGAGGAATAAAAGTCA
AACGATGAAGCATTTAAAACTCCGTTTTATATATTAGAAGAGCTCAATAAGACTCTGCCC
AAGAGGACAACAGTGGAAACATCTTTAAAGAGTGATGCAACTGAAAAAAAAGATAACTTG
GAGCAAAGCGAGGATAGCAAGGTTTTACAAAACAATTATGATGAATGCAGCAATAGTGAA
TTTAGAGACTCAAGCAGCAATATGATGCAAATGATAGAACTTGATTCGACAGTTTTAGAT
TAGGATAAAATAATTGAAGAGCAGAAATAAAGCGAACTGCAAACTAATTACTAAAACACT
TCTAATAGTAATAAGGATAAGATGTTTGTTGTCCCTATTCCTAAATCAAGCCAGTCTAAA
GAAGTAAAGGATATCAATAATTAAGAAGATGCTGAATAAAGCTCTAAGAAACTTTAGAAA
AAGCCCAACAAGCTTTCTGATGATGAAAAATCTCGTGTGTACAAAAAATTTATAATTGAA
TATGTAAAATTGAATAGAAGCAAACTGCAAGGACCTTAGAGCTTGTACATAATTCATCCT
GAAATGATGTAAATCATGCAAATTTAAGCTGCATTACCTTAACGTAAATGGAAAAAGGAA
ATAGCTCATTTCTTTGTACAAAAAGAGTGTCTAAATCCTATTTAAAAAGAGGTTTAAATA
AAAAAGTGCATTAATTAGAGAATAATTGATTTATTCTCTGACAGAAATATTCCAACAAAC
ATTCCTTCTAAAAATTTCTATAAACTTTTCAAAGCCAATTTCATGATTAAAGTTTATGAC
AACGTCAAATAACTCTCAGAGTATGAAGATATTTTAGACAACGCATAAGAAAGCTAAGAA
AATTAAGATAATTAAGTAAAACCTACAAGTCTAAGCTAAGAAGAAAACGAAATATAACCA
AATTAAATTGCTTAGAATTAACAATAAACAACTGAAATATGTAAAAAATAATAGGATTAA
CCATTAAAAGATAACTAGATTGTTGAAGAAAATGCTGTTGATCATGAAAAATTATGCCAA
AATTTACCAGAAAAAATGCAAGAAGAAAAAATTCAAAATGGAGATATTCATTAATAAATA
TAAAGTGATTAATAGGAAAATTAAGCTGTTTAACAAGATAATAAAGATGCTTAATAGGAA
ATTTAGAAAGATTAGCAAGAAAATAAAGATTTTTAGAAAAATTAGAATCCTTAAGAAGAG
AGTAAAAATGTTGATAGTGAAAAAATCGTCTAAAATGAAAATTAAAATGTCATCGAAGAA
GAAATTTAGAAACCTTAATCAGAAAATAAAAATATTGAACAAGAAAATCAAAATATTTAA
TAGCAAGTTTAAAATGTTTAATCAGAAGATTAAAATATTTAACAAGAAATAAAAAGTAAT
TAATAGGAAAATTAAAATGCTTAGTAAGATGATTAAAATTTAAAACAAGATAATTCAAGT
GATAAACAAGAAAATTTAAATATTTAGGAAGAAAATCAAAAGGTTTAGTAAGAAAATGAA
AGTACGTAATAAAATAATTAAAATGTTGAATAAGAGCATAGCTAATAAGAAAAATAAAGT
GAAAAAGATATTTTAGCTGAATTACCAGAATCAGTAAATCAAAAAGATGATTTGAAAAAC
ACAGAAACATAAAATAAGTAATAAGAAAATGAAAGTTTTAAATAAAACCCAACATAAGAA
AGTGAAAGTAAAATGTAGATAGAAAGTGAATAACCTAATTTATAAGTTGAAGAATAAACA
GTAAATGATCATTAAAAAATGCAAATTGAAGATGGAGAAGATAAAGCTCCATAGTAAGAA
TAAGTATAAGAAGTTGTTTAAAATTAATAGTCAGAGAGCAGTTCTAACAACAACCAATGA


>TTHERM_00222270(protein)
MSVLNPTQEQLSVLKEHYKDIILNWPEGYDFCEVCLIKEGMQQDDLIFCELCNGLVHQSC
YGGELLDSIPENDWYCERCREYIRDYMNEQKLHDLSSIRCYFCPEQKGIVKKVTIQHSGT
QIWSHVGCVSSIKSLNFVDSTRNLIVQKYSPKRTTDECKICGLKTGNCGYCHTSGCNFTF
HFSCGKRIGIIQDVITMNTLMECREKQYKNSEPEHHVVFCEEHLYNLSYVEYPNDKFLKE
FIQNMYIQRETFENEGDNLSVLIANQQKCDKIEYNKSQLQEKYIQKKQQLRKSKKTSSNS
LPQSKQNIRDKSRSRSRSRSPPKSDRKIAGGKKPKSSESQLEISEKEIGASKKPAQKSKA
AQSQSQTGSKAPSKGKKEEENKSQQSNPTQAGKSKGGISSSQSLSQNDKANKSKVAATTA
AVSLQPQNQQTSSKNDQNSQSGLSQTKKQTKKGKNDDEQSNQLIENQDNWRRIQNVMQKY
DYREKQFNNNSNNNSEEQKSNDEAFKTPFYILEELNKTLPKRTTVETSLKSDATEKKDNL
EQSEDSKVLQNNYDECSNSEFRDSSSNMMQMIELDSTVLDQDKIIEEQKQSELQTNYQNT
SNSNKDKMFVVPIPKSSQSKEVKDINNQEDAEQSSKKLQKKPNKLSDDEKSRVYKKFIIE
YVKLNRSKLQGPQSLYIIHPEMMQIMQIQAALPQRKWKKEIAHFFVQKECLNPIQKEVQI
KKCINQRIIDLFSDRNIPTNIPSKNFYKLFKANFMIKVYDNVKQLSEYEDILDNAQESQE
NQDNQVKPTSLSQEENEIQPNQIAQNQQQTTEICKKQQDQPLKDNQIVEENAVDHEKLCQ
NLPEKMQEEKIQNGDIHQQIQSDQQENQAVQQDNKDAQQEIQKDQQENKDFQKNQNPQEE
SKNVDSEKIVQNENQNVIEEEIQKPQSENKNIEQENQNIQQQVQNVQSEDQNIQQEIKSN
QQENQNAQQDDQNLKQDNSSDKQENLNIQEENQKVQQENESTQQNNQNVEQEHSQQEKQS
EKDILAELPESVNQKDDLKNTETQNKQQENESFKQNPTQESESKMQIESEQPNLQVEEQT
VNDHQKMQIEDGEDKAPQQEQVQEVVQNQQSESSSNNNQ


>TTHERM_00222270(gene)
ATGAGCGTTTTAAATCCAACATAAGAACAATTATCAGTGCTAAAAGAGCATTATAAGGAT
ATTATTTTGGTAAATAACAAATTATTCATATTCATTATAATTTTAAATTGCATTTCATTT
CTCAAATTCATTCTAATTTACTTAGAACTGGCCTGAAGGTTACGATTTCTGCGAAGTTTG
TCTAATTAAAGAAGGAATGCAACAAGATGATCTAATTTTTTGTGAACTCTGTAATGGCCT
TGTTCACTAAAGTTGTTACGGAGGAGAACTGCTTGATAGCATTCCAGAAAGTAAAACAGT
TCATTGATTAATTTTATACTAAAATAGATAGATATATTGATATTCTGCAATTTTAATTCA
AATATTTGCTTTTTCATTGTTTAGAAAACTTTAAACTTATTATTAGATGATTGGTATTGT
GAAAGATGCAGAGAGTACATCAGAGATTATATGAACGAGTAGAAATTGCACGACTTGTCT
AGCATTAGATGCTACTTTTGCCCTGAATAAAAAGGAATAGTCAAAAAAGTCACTATTCAA
CATTCAGGAACGTAAATATGGTCGCATGTTGGTTGCGTTTCTTCAATAAAATCTTTGAAC
TTTGTTGACAGGTAAGAATTGATTGATTGATTTATATTATATTGTATTGTTAATTAATTA
GTAGTAAACGGGTAATTAATTTAATAAATCAAAAAAGATTTCAATTAGATTGAATCAACA
TAAAGAATGTTAAAACAAACAAGCAAACAAACTATTTATTAATTTATTTATTCAATATCT
ATTTGGTAAACTCTTAAATAGATAGATATTGATAATCTACCAACTTAATAAATAAACTTT
TAGTGAAATTTAGTTATAATTAATTCCTAATTGATTATCAAAAATACAACAAATACCCTC
TAATTTTTTCTTCGCTTCACTTTGATCATAAATTGAATTTTAATTTTTATAAATAGTACA
AGAAATCTCATAGTTTAGAAATACAGTCCTAAGAGGACAACTGATGAATGCAAGATATGT
GGGCTAAAGACAGGAAATTGCGGCTATGTGAGTTCTTTATTTTATCAAAATTTTAACGAT
ATTTCATAAAAATTTTATCTTCTTACTTACTGCATTATTGCAATCAAAATTTAGCGCGAA
ATACATTTTAAGCGCGTTAAAATTAATTAGTATACAAATTAATCAAAATTTTTATTTATT
TATTTTTAATATGAAAACAGTGCCATACTTCTGGATGCAATTTCACTTTCCACTTTTCGT
GTGGGAAAAGGATAGGAATCATACAAGATGTAATTACCATGAACACGTTAATGGAATGCA
GAGAGAAATAGTACAACTTTTTTTTTTGTTTTTAGAGTTGCTTACTTAATATTTATTTTT
TAGGTACAAAAATTCTGAACCAGAGCATCATGTTGTCTTTTGCGAAGAACATCTCTATAA
TTTAAGCTATGTCGAATATCCTAATGACAAATTTCTCAAAGGTAGCTTCAAAATTATTTT
AAAAGTAAAGGATTATTTATAAGTTTTATAATTATTAACAGAATTCATTTAGAATATGTA
CATTTAAAGAGAGACATTTGAAAATGAAGGAGATAATTTGAGTGTGTTGATAGCAAATCA
GTAAAAATGTGATAAAATTGAATACAACAAAAGCTAGCTTTAAGAGAAATATATATAGAA
AAAATAATAGCTACGTAAAAGTAAGAAAACAAGCTCTAACTCTTTGCCACAATCAAAGCA
AAATATCAGAGATAAAAGTAGAAGTAGAAGTAGAAGTCGCTCTCCTCCAAAAAGCGATAG
GAAAATTGCAGGGGGTAAAAAGCCTAAAAGTTCTGAATCCCAATTAGAAATTAGTGAAAA
GGAGATCGGAGCATCAAAAAAACCTGCTTAAAAATCTAAGGCGGCTTAATCATAATCGTA
GACTGGCTCCAAAGCTCCTTCTAAGGGTAAGAAAGAAGAAGAAAATAAAAGCTAACAATC
CAATCCAACTTAAGCTGGAAAATCTAAAGGTGGCATTTCATCTTCATAGTCACTCTCTCA
AAATGACAAAGCAAACAAATCTAAGGTAGCAGCAACAACAGCAGCAGTTTCTTTGTAGCC
ATAAAATTAACAAACCTCATCTAAAAACGACTAAAATAGTTAATCTGGTTTAAGCTAAAC
AAAAAAACAAACAAAAAAGGGTAAAAACGATGACGAACAAAGCAATTAGCTTATTGAAAA
TTAAGATAATTGGAGGAGAATACAAAATGTTATGTAGAAGTATGATTATAGGGAAAAATA
ATTTAATAATAATAGTAACAATAACTCAGAGGAATAAAAGTCAAACGATGAAGCATTTAA
AACTCCGTTTTATATATTAGAAGAGCTCAATAAGACTCTGCCCAAGAGGACAACAGTGGA
AACATCTTTAAAGAGTGATGCAACTGAAAAAAAAGATAACTTGGAGCAAAGCGAGGATAG
CAAGGTTTTACAAAACAATTATGATGAATGCAGCAATAGTGAATTTAGAGACTCAAGCAG
CAATATGATGCAAATGATAGAACTTGATTCGACAGTTTTAGATTAGGATAAAATAATTGA
AGAGCAGAAATAAAGCGAACTGCAAACTAATTACTAAAACACTTCTAATAGTAATAAGGA
TAAGATGTTTGTTGTCCCTATTCCTAAATCAAGCCAGTCTAAAGAAGTAAAGGATATCAA
TAATTAAGAAGATGCTGAATAAAGCTCTAAGAAACTTTAGAAAAAGCCCAACAAGCTTTC
TGATGATGAAAAATCTCGTGTGTACAAAAAATTTATAATTGAATATGTAAAATTGAATAG
AAGCAAACTGCAAGGACCTTAGAGCTTGTACATAATTCATCCTGAAATGATGTAAATCAT
GCAAATTTAAGCTGCATTACCTTAACGTAAATGGAAAAAGGAAATAGCTCATTTCTTTGT
ACAAAAAGAGTGTCTAAATCCTATTTAAAAAGAGGTTTAAATAAAAAAGTGCATTAATTA
GAGAATAATTGATTTATTCTCTGACAGAAATATTCCAACAAACATTCCTTCTAAAAATTT
CTATAAACTTTTCAAAGCCAATTTCATGATTAAAGTTTATGACAACGTCAAATAACTCTC
AGAGTATGAAGATATTTTAGACAACGCATAAGAAAGCTAAGAAAATTAAGATAATTAAGT
AAAACCTACAAGTCTAAGCTAAGAAGAAAACGAAATATAACCAAATTAAATTGCTTAGAA
TTAACAATAAACAACTGAAATATGTAAAAAATAATAGGATTAACCATTAAAAGATAACTA
GATTGTTGAAGAAAATGCTGTTGATCATGAAAAATTATGCCAAAATTTACCAGAAAAAAT
GCAAGAAGAAAAAATTCAAAATGGAGATATTCATTAATAAATATAAAGTGATTAATAGGA
AAATTAAGCTGTTTAACAAGATAATAAAGATGCTTAATAGGAAATTTAGAAAGATTAGCA
AGAAAATAAAGATTTTTAGAAAAATTAGAATCCTTAAGAAGAGAGTAAAAATGTTGATAG
TGAAAAAATCGTCTAAAATGAAAATTAAAATGTCATCGAAGAAGAAATTTAGAAACCTTA
ATCAGAAAATAAAAATATTGAACAAGAAAATCAAAATATTTAATAGCAAGTTTAAAATGT
TTAATCAGAAGATTAAAATATTTAACAAGAAATAAAAAGTAATTAATAGGAAAATTAAAA
TGCTTAGTAAGATGATTAAAATTTAAAACAAGATAATTCAAGTGATAAACAAGAAAATTT
AAATATTTAGGAAGAAAATCAAAAGGTTTAGTAAGAAAATGAAAGTACGTAATAAAATAA
TTAAAATGTTGAATAAGAGCATAGCTAATAAGAAAAATAAAGTGAAAAAGATATTTTAGC
TGAATTACCAGAATCAGTAAATCAAAAAGATGATTTGAAAAACACAGAAACATAAAATAA
GTAATAAGAAAATGAAAGTTTTAAATAAAACCCAACATAAGAAAGTGAAAGTAAAATGTA
GATAGAAAGTGAATAACCTAATTTATAAGTTGAAGAATAAACAGTAAATGATCATTAAAA
AATGCAAATTGAAGATGGAGAAGATAAAGCTCCATAGTAAGAATAAGTATAAGAAGTTGT
TTAAAATTAATAGTCAGAGAGCAGTTCTAACAACAACCAATGA