Identifiers and Description

Gene Model Identifier

TTHERM_00171790

Standard Name

NMDP1 (Nonsense Mediated Decay Protein 1)

Aliases

PreTt29788 | 14.m00355

Description

Mediates cleavage of target mRNA strands

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.7%

TetraMine Data

TTHERM_00171790

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_09962.19.997093137033517e-262hypothetical protein (986 aa)
OxytrichaContig13105.0.g801.999981404597394e-31Zc3h12a-like Ribonuclease NYN
domain
DictyBaseDDB_G02767132.0009605191578312e-25DDB_G0276713 on chromosome: 2
position 7112533 to 7116132
WormBaseWBGene000162600.00000019998969434520019status:Confirmed UniProt:Q95
YE2 protein_id:CCD66238.1

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000384

Sequences

>TTHERM_00171790(coding)
ATGGAATAGCGATTTAAATATAACGGTAGAGGATAAAAGCCATCTTCTAATTAAAGCAAC
TAGGGGTACAATAACAACAACAATAATAGCAATAACAATAACAATGGATCTTAGATTTAA
TTTAAAGATAGAGAAAGAGAAGAAGAAGAGCATTATTACTAAGCGTAAAATAAAAGAAGG
TAGTAAAAAGTTTACCAAGAGTATGAAACTAAGTAAGTTAATTAGGACAACGGTAATAAC
CATCAAGCATAGAAGAATAATCAAAAAAATTAGCAAAGAGATTAGAATAAAAACAATAAT
TCTAATAATGACAACAGAAATCAAAATAATGGATAAAGGCAGAATGGAAAATAAAATGAT
TTTTACCCTAGAAATTAATTTAGGTAAGTGAATGATGATTACGATGACGATGAAGATGAT
GATAGCTCTTTCAATAATTCTAGAAATAGCAAAAAAAAGAATACAAACAGAAATAACAAT
CAGAACAGATAATAAAAATAATATGATAGCAGTGATGATGATTACAGCGATGGCAGAAGA
AGAAATAAAAGAGAGAAAAAAATAGACCCAAATGGACACAATCCAAATGCAAATGTTGAT
TAGCAATACGACAGATCGAAAATTGAGCATTATTTTAACAGCAAAGACATCAAATTTAGT
AAAGACAAAAGGTTTAATATCTATCACTAAAGAGATGATGAATACTTTCACAACTCTAAA
AACAGAAACGGCTAAAATAAATTTGAAGGCAGCAGCTCAAACAGTAACCACCACAATAAT
TAGAAAAACAATGAAGAATTTGACATCGACAGTATTGTAGATTAAGTTGATTTTTAGGTT
AACTTAGATGATATCTTTAAAGAGACAAACATGGAAGAATATGAATGGAATAACTTATAC
CAATTATTTAAATTATCAGAAAAGAAAAACTCTCTATTTTTCACAATGTAAAGTGAAAAT
CAAGTTATTTTTGATAAGCAAGAAATGGAAACTGAAATCTTTAAGCTATTCTAGCAACTT
GCAAGAGTTCTTATTTTATCTGACTTAGAAACAGCCAGTGAAAAAAAAATTGACTAAAGA
CTGTGGGATATTTACAAAAAGAAGATTGAGTATAGCAAAAAGTTTAAACTTGTAAGCACA
AATATCTAAGATTAGCTCCATATTTTCGATTCTAAGATTTAATTCTTAAGAGGATTGCTA
AAGGATGTTATTGAGAAATACAAGTCTGAGCTATGTTCTGAAATCAAATAAAAGAACTAA
AAAAGAAGAATAATCGCTAATTTATGTTGCTACTTTGGAGAACTTATTGAATTGAAAGAG
AAAGTTTCAAGAACATAGACAGCTCCAAATATTAAGAACATGCATTTTGCAGCTGGTTAA
TATATGAAAGCTATTAGCATTTATCCCTTTTGTGGGAAGTTCTTTTTGGTCTTAGCAACT
TTAAGTTACATGAGTGATGATCAGTTTTCTGCAATCTACTGGTGTATAAGAGCACTTTGC
AGTCAATAATCTTATCCTTGTAAGGAAAATTTGCAGGAATTTTTAGAAATAAACAGATAA
AAGTGCTACTAGTTTATGCAGGAACATAATAGTTATGGAAAGATAGATAAGAGAGATACA
TTTAAACTCTTCATTTTACACTTTTTGAGTTTTGTTAACATTGTTCTGACAAAGATTGGA
ATTGAAAATATGTAAATACATGCTCCCATGTTTGAATATTTGCAATAGCATTTGCAACTT
TTGTAATAACAAATTTAATCTCAATAAGAGGTAAGTTTGAAAGATCAAACTACACTATTA
ACCTATGTAATTATGATGGTAGTTTTTTCATTAAGTAAATTTCAAGAGTATATAAAGCTC
AAAGAAGGTTAAGTTTTAGATGTAAAGATTCTTGAAAATGATAATTTGGCTAGCAACTGT
TTGAAATACACTTATGGAATCCTGAATATGATCCTTGAGCTTTATGTCAATTATGATGTA
CCTTATTTTACTGATTTAGTTATTCCTATAATCTGCTATTTCATCTCTTACTAGGCTGTT
TCTGATTACCTTTTCACTAAATTCTCACATTTCTAAACTCTTTTTAACAAGATTCTGTAA
AAAACCAAGCAAAGATTTGCTGAATTTGAAAAGCACAAGCCTAAAAGCTACTATGAAACT
CTATGCGACAACTATTTGTGTGACACTGAAATTCAAATGATAGGCTATACACCATTTAAC
CATTACTTCGAGAACAACAAGGATAAGTTTAAAATCCTTGAAGATGACTCTCTCTAATAC
CCTCTTAAACTCTTTATTATCCTAGATAAGCTTCCAAAAATAGAGTCTTTCAAAATTTTG
GAAGAAGACGAATAAGTTGATTCAAATAAACAAGACCAAGAAGATTTCTTTTTCTTGAAA
ACAACTCCCTAAAAAGAAAGTAGTGCATAGCAAGATAGCAAGCAATTGATAATCATAGAT
GGTATGAATGTTGCTATCAGATATGGTTAATCTACCTTCTGTGCTAAAGGCCTCCAGATT
GTTGTTGATTTTTGGCTTAACCATCAGGCTGAAGTGCTTGTATTTTTACCAGATTTCTGT
TTTAGTGCTGATTAAATCGAAAAGAAAAGATAGAAATTCCAAAAAGAAAAAATTCCTGAA
AAGTTCAAGACTTTGCCAGACGAAGTAGAAACTTTAATCAAGTTAAGAGACCAGGGTTAT
GCTACAGGTATACCAAACTAGAGCTATGATGACTCTTACATGATAGATTATGCAAGAAAG
AAGAATGCATTCATCATGACTAATGATAGATATAATGACCATATTTAGAACTACAAAAAT
GATCCAAAATAAATGGAAATCGTTAAGTAGTGGATTAGAAACAACTGTATGAGCTTTACT
TTTGTTAAGGATGAGCTGCAACCTGACCCTGATTTCATATAGAAAAGAACGAAAATATCT
CTAGAAAAGCCCTACCAATGA


>TTHERM_00171790(protein)
MEQRFKYNGRGQKPSSNQSNQGYNNNNNNSNNNNNGSQIQFKDREREEEEHYYQAQNKRR
QQKVYQEYETKQVNQDNGNNHQAQKNNQKNQQRDQNKNNNSNNDNRNQNNGQRQNGKQND
FYPRNQFRQVNDDYDDDEDDDSSFNNSRNSKKKNTNRNNNQNRQQKQYDSSDDDYSDGRR
RNKREKKIDPNGHNPNANVDQQYDRSKIEHYFNSKDIKFSKDKRFNIYHQRDDEYFHNSK
NRNGQNKFEGSSSNSNHHNNQKNNEEFDIDSIVDQVDFQVNLDDIFKETNMEEYEWNNLY
QLFKLSEKKNSLFFTMQSENQVIFDKQEMETEIFKLFQQLARVLILSDLETASEKKIDQR
LWDIYKKKIEYSKKFKLVSTNIQDQLHIFDSKIQFLRGLLKDVIEKYKSELCSEIKQKNQ
KRRIIANLCCYFGELIELKEKVSRTQTAPNIKNMHFAAGQYMKAISIYPFCGKFFLVLAT
LSYMSDDQFSAIYWCIRALCSQQSYPCKENLQEFLEINRQKCYQFMQEHNSYGKIDKRDT
FKLFILHFLSFVNIVLTKIGIENMQIHAPMFEYLQQHLQLLQQQIQSQQEVSLKDQTTLL
TYVIMMVVFSLSKFQEYIKLKEGQVLDVKILENDNLASNCLKYTYGILNMILELYVNYDV
PYFTDLVIPIICYFISYQAVSDYLFTKFSHFQTLFNKILQKTKQRFAEFEKHKPKSYYET
LCDNYLCDTEIQMIGYTPFNHYFENNKDKFKILEDDSLQYPLKLFIILDKLPKIESFKIL
EEDEQVDSNKQDQEDFFFLKTTPQKESSAQQDSKQLIIIDGMNVAIRYGQSTFCAKGLQI
VVDFWLNHQAEVLVFLPDFCFSADQIEKKRQKFQKEKIPEKFKTLPDEVETLIKLRDQGY
ATGIPNQSYDDSYMIDYARKKNAFIMTNDRYNDHIQNYKNDPKQMEIVKQWIRNNCMSFT
FVKDELQPDPDFIQKRTKISLEKPYQ


>TTHERM_00171790(gene)
ATGGAATAGCGATTTAAATATAACGGTAGAGGATAAAAGCCATCTTCTAATTAAAGCAAC
TAGGGGTACAATAACAACAACAATAATAGCAATAACAATAACAATGGATCTTAGAGTAAA
TTCTGAAATATTCATTGCATTTATTTAGGCTTTTGCTCAAAATTAATTAATTAAATAATT
AATTTCAATAGTTTAATTTAAAGATAGAGAAAGAGAAGAAGAAGAGCATTATTACTAAGC
GTAAAATAAAAGAAGGTAGTAAAAAGTTTACCAAGAGTATGAAACTAAGTAAGTTAATTA
GGACAACGGTAATAACCATCAAGCATAGAAGAATAATCAAAAAAATTAGCAAAGAGATTA
GAATAAAAACAATAATTCTAATAATGACAACAGAAATCAAAATAATGGATAAAGGCAGAA
TGGAAAATAAAATGATTTTTACCCTAGAAATTAATTTAGGTAAGTGAATGATGATTACGA
TGACGATGAAGATGATGATAGCTCTTTCAATAATTCTAGAAATAGCAAAAAAAAGAATAC
AAACAGAAATAACAATCAGAACAGATAATAAAAATAATATGATAGCAGTGATGATGATTA
CAGCGATGGCAGAAGAAGAAATAAAAGAGAGAAAAAAATAGACCCAAATGGACACAATCC
AAATGCAAATGTTGATTAGCAATACGACAGATCGAAAATTGAGCATTATTTTAACAGCAA
AGACATCAAATTTAGTAAAGACAAAAGGTTTAATATCTATCACTAAAGAGATGATGAATA
CTTTCACAACTCTAAAAACAGAAACGGCTAAAATAAATTTGAAGGCAGCAGCTCAAACAG
TAACCACCACAATAATTAGAAAAACAATGAAGAATTTGACATCGACAGTATTGTAGATTA
AGTTGATTTTTAGGTTAACTTAGATGATATCTTTAAAGAGACAAACATGGAAGAATATGA
ATGGAATAACTTATACCAATTATTTAAATTATCAGAAAAGAAAAACTCTCTATTTTTCAC
AGTAAATAAATAAATAAACAATTACATTAAATTAAATTAACATACATGCTAACATGCATA
TCTAAATATTAATTTGTACTCGCATCAATCCATTCATTAATTTTTTTATTTAATTCACTA
TTTATAAAAAGATGTAAAGTGAAAATCAAGTTATTTTTGATAAGCAAGAAATGGAAACTG
AAATCTTTAAGCTATTCTAGCAACTTGCAAGAGTTCTTATTTTATCTGACTTAGAAACAG
CCAGTGAAAAAAAAATTGACTAAAGACTGTGGGATATTTACAAAAAGAAGATTGAGTATA
GCAAAAAGTTTAAACTTGTAAGCACAAATATCTAAGATTAGCTCCATATTTTCGATTCTA
AGATTTAATTCTTAAGAGGATTGCTAAAGGATGTTATTGAGGTAATTTTTCCATTCAAAA
ATTACTTTGTAAAATAATAAAAATTTTATAGAAATACAAGTCTGAGCTATGTTCTGAAAT
CAAATAAAAGAACTAAAAAAGAAGAATAATCGCTAATTTATGTTGCTACTTTGGAGAACT
TATTGAATTGAAGTAAAATTTAATTTAGTTAAGGAAATATTTTTTTTATTTTTCTTTGTT
AATTAAATAAAGAGAGAAAGTTTCAAGAACATAGACAGCTCCAAATATTAAGAACATGCA
TTTTGCAGCTGGTTAATATATGAAAGCTATTAGCATTTATCCCTTTTGTGGGAAGTTCTT
TTTGGTCTTAGCAAGTAAAATAAATTAAATAGGATTTTTTTCAATATAAATTATTTAAAT
TTAGCTTTAAGTTACATGAGTGATGATCAGTTTTCTGCAATCTACTGGTGTATAAGAGCA
CTTTGCAGTCAATAATCTTATCCTTGTAAGGAAAATTTGCAGGAATTTTTAGAAATAAAC
AGATAAAAGTGCTACTAGTTTATGCAGGAACATAATAGTTATGGAAAGATAGATAAGAGA
GATACATTTAAACTCTTCATTTTACACTTTTTGAGTTTTGTTAACATTGTTCTGACAAAG
ATTGGAATTGAAAATATGTAAATACATGCTCCCATGTTTGAATATTTGCAATAGCATTTG
CAACTTTTGTAATAACAAATTTAATCTCAATAAGAGGTAAGTTTGAAAGATCAAACTACA
CTATTAACCTATGTAATTATGATGGTAGTTTTTTCATTAAGTAAATTTCAAGAGTATATA
AAGCTCAAAGAAGGTTAAGTTTTAGATGTAAAGATTCTTGAAAATGATAATTTGGCTAGC
AACTGTTTGAAATACACTTATGGAATCCTGAATATGATCCTTGAGCTTTATGTCAATTAT
GATGTACCTTATTTTACTGATTTAGTTATTCCTATAATCTGCTATTTCATCTCTTACTAG
GCTGTTTCTGATTACCTTTTCACTAAATTCTCACATTTCTAAACTCTTTTTAACAAGATT
CTGTAAAAAACCAAGCAAAGATTTGCTGAATTTGAAAAGCACAAGCCTAAAAGCTACTAT
GAAACTCTATGCGACAACTATTTGTGTGACACTGAAATTCAAATGATAGGCTATACACCA
TTTAACCATTACTTCGAGAACAACAAGGATAAGTTTAAAATCCTTGAAGATGACTCTCTC
TAATACCCTCTTAAACTCTTTATTATCCTAGATAAGCTTCCAAAAATAGAGTCTTTCAAA
ATTTTGGAAGAAGACGAATAAGTTGATTCAAATAAACAAGACCAAGAAGATTTCTTTTTC
TTGAAAACAACTCCCTAAAAAGTAACTAAATCTAAAATTTATTTAATAATAAAAAATGAA
ATATTCTAAAAAAGATTATATTATTAATTAGCAAATACAAATTTGCAAAAAGTAAAATAA
GGATTTTCTATTGAATAATAAAAATGAATGATAAATTATTTGAAAGAAATAGAATTGATT
CCTATAAAAAAATATGATCAAAAGGATCAAAGATAAGAAAAGAATTAATTTTATTTTAGA
ATGTTTTGCAAAAGAAATATTAAATAATATCTTAAAAATGATTCCAATAAATTTATTAAA
ATAAATACTTAAAAACAGAAAAGAAATTTAAACCAAATAAAATAAATTTTTTAAAGCAAA
ATTTTGAAATAAATTAAAGAATGCAAAAATATATTTTTTAATGCAAAATTGAGAAATACT
CCTTAAAATGATTAATTAATTTTATGATTTTGTTTTTATTAGGAAAGTAGTGCATAGCAA
GATAGCAAGCAATTGATAATCATAGATGGTATGAATGTTGCTATCAGATATGGTTAATCT
ACCTTCTGTGCTAAAGGCCTCCAGATTGTTGTTGATTTTTGGCTTAACCATCAGGCTGAA
GTGCTTGTATTTTTACCAGATTTCTGTTTTAGTGCTGATTAAATCGAAAAGAAAAGATAG
AAATTCCAAAAAGAAAAAGTAAACAAACAAATAAATAAATAAATAAAAAATATTGTGTTG
TTTTTATGTTAATTTAATTATTTTCATCTTAAAATAAAGATTCCTGAAAAGTTCAAGACT
TTGCCAGACGAAGTAGAAACTTTAATCAAGTTAAGAGACCAGGTAAATAAATTTGATCAA
AGAAATTAATAAATAAAGATTTTGAAATTAATTCAGATTTTAAATTATTTAATTAGGGTT
ATGCTACAGGTATACCAAACTAGAGCTATGATGACTCTTACATGATAGATTATGCAAGAA
AGAAGAATGCATTCATCATGACTAATGATAGATATAATGACCATATTTAGAACTACAAAA
ATGATCCAAAATAAATGGAAATCGTTAAGTAGTGGATTAGAAACAACTGTATGAGCTTTA
CTTTTGTTAAGGATGAGCTGCAACCTGACCCTGATTTCATATAGAAAAGAACGAAAATAT
CTCTAGAAAAGCCCTACCAATGA