Identifiers and Description

Gene Model Identifier

TTHERM_00470530

Standard Name

NMD3 (nonsense-mediated mRNA decay protein 3)

Aliases

PreTt22467 | 56.m00171 | 3686.m00014

Description

NMD3 family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00470530

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_11389.19.997093137033517e-262NMD3 family protein (628 aa)
OxytrichaContig20934.0.g474.998599334973554e-137NMD3 family
DictyBaseDDB_G02713064.000347951747671e-122nmd3 on chromosome: 2 position
129822 to 131608
SGDYHR170W1.0000409741368237e-118NMD3 Protein involved in nucle
ar export of the large ribosom
al subunit; acts as a Crm1p-de
pendent adapter protein for ex
port of nascent ribosomal subu
nits through the nuclear pore
complex
WormBaseWBGene000120304.0002634815779907e-110status:Confirmed UniProt:Q22
792 protein_id:CAA96689.2
Stentor CoeruleusSteCoe_149443.817497188671175e-54

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00470530(coding)
ATGTAGGGAGCCTCATAGTTATTAAACATTAGTGCAAGATCAAATGGATCTCAATTTATG
AGCAGCACTTTCTAAAGAGTCACCGCAAACATCCTCTGTTGTATGTGTGGTGTCTCCTTT
AATGCTGCCTAAACAAGAACAAATATGTGTGTTAATTGTTTAACCAATTAACAAGATATT
ACTACAGGAATTACTAAATAGGGAGTAGTTAATTTTTGTCGTATGTGCAGACGTTACAAC
AAACCACCTTGGGTTTATTGTGAACGTGAAAGCAAAGAAATGCTCTCTCTTTGTCTTAAG
AAGATTAAGGGTCTTGAGAAGGTTAAACTCATAGACAGTGCTTTCTTGTATACTGAACCC
CATTCTCGTCGTATTCGTATCCGTCTTACTATCTAAAAAGAAGTCATGAATAATACTTCT
ATCTAATAAAATTTTGTCGTTGAATTCGTAGAACACTACGGCTAGTGTGATGACTGTAAA
AAGGAATTTACTCCTCACACATGGGGTGCTTAAGTCTAACTTCGTTAAAAAGTTGAACAC
AAAAAGACTTTCTTCTTCTTAGAATAAGTTATGTTAAAGCATAATGCTCACGATAAAGTT
TTGAAAGTAGAAGAAAAGGATGATGGTTTAGATTTCTTCTATAAAAATAAAATGTAAGCA
AATCGTTTGGTAGACTTCATATAAAGTGTTATCCCCTGCAAGATTAAGCCTTCCAAACAG
CTTATCGGACTTGACGATCGTAACAATATTTACAATTACAAATATTCTTGGTCTGTTGAA
ATTCCTAAAATATGCAAGGATGACTTGTGTGTTTTCCCTCCTAGATTATGCAAAGAGTTA
GGAGGTATCAGTCCTCTTGTATTATGTGTTAAAGTTAGCAATATGCTCCATTTCGTAGAT
ACTCACACTCATAAGCGTATTGACATCACTGCTGAAAGATACTTCCATTATGAAAACGAC
ATTATTGTTCTCTCCTTAAAGAAAAACTCTACTGAATTTATGGTTACTGGTATTGAAAAA
ATTGAAAATGAATTTACTAATCCCTAAAGCTTGAATGAATCCTCTGTTAACACCAGTTAC
ATGTCTTCAATCAGCAACGTTTACTAAGATAAACTAGCTCACTTAACCCTCATGCGTACT
AGCGATTGGAAAGAATTCCATGCTAAAGCACATCTTGGTGAAATTATTAAGGAAGGATGC
ATGGTTTTGGGTTATGATTTGACAACATTGAACTACTCTGAAGACCTTGAAGTTCTTAAA
AATGCTCCTGAAATTATTATTGTCAAACGTATTTATGATAAGGAAAATAAAGCCCGTATT
TGGAAGCTTAAGCGTTTATAGATGGATGGTGTTATGGTTGAAGAAAATACCGAAGAAGCT
AATAAGAAGGGCAAGAAAAAAATAGTCTCAGACTAGGATAAAGAATAAGATTTTGAAGAG
TTTATGGATGACATAGAACGTGATCCTCTTATGCGTGAAAAAATTAATTTATATAAGGAT
GATGAAGGAATTAAAAAGCTCTCAGATAAGGAACTTGCAAGAAAGCAATAACTTTCCAGA
CGTCTTAAAAGAAAAATGCTTAAAGTTATTAACGTTAAAGTTAAAGATCCCTAAGAAATT
ATCAGATAACAAGAAGAAGAATTATAAGAGAAGCTTCGTATCGCAGAAGAAAAGAGGGCT
GAAAAGGAAGCTAAAAAGAAAGAAAAGGAAGACGAAGAAGACTACAACCGTAACGAAGTT
AAGTTGGCTGAATTATTAGAAGATCTTAATCTTGAAGAAGATAAAGGTGAAGAAGATGGA
GACAAAGTCTTTGATGAAGACAATTTCATTGACGAATTTATTAAAAGACTTGATCATATT
AAAATTGAAAAGTAATGA


>TTHERM_00470530(protein)
MQGASQLLNISARSNGSQFMSSTFQRVTANILCCMCGVSFNAAQTRTNMCVNCLTNQQDI
TTGITKQGVVNFCRMCRRYNKPPWVYCERESKEMLSLCLKKIKGLEKVKLIDSAFLYTEP
HSRRIRIRLTIQKEVMNNTSIQQNFVVEFVEHYGQCDDCKKEFTPHTWGAQVQLRQKVEH
KKTFFFLEQVMLKHNAHDKVLKVEEKDDGLDFFYKNKMQANRLVDFIQSVIPCKIKPSKQ
LIGLDDRNNIYNYKYSWSVEIPKICKDDLCVFPPRLCKELGGISPLVLCVKVSNMLHFVD
THTHKRIDITAERYFHYENDIIVLSLKKNSTEFMVTGIEKIENEFTNPQSLNESSVNTSY
MSSISNVYQDKLAHLTLMRTSDWKEFHAKAHLGEIIKEGCMVLGYDLTTLNYSEDLEVLK
NAPEIIIVKRIYDKENKARIWKLKRLQMDGVMVEENTEEANKKGKKKIVSDQDKEQDFEE
FMDDIERDPLMREKINLYKDDEGIKKLSDKELARKQQLSRRLKRKMLKVINVKVKDPQEI
IRQQEEELQEKLRIAEEKRAEKEAKKKEKEDEEDYNRNEVKLAELLEDLNLEEDKGEEDG
DKVFDEDNFIDEFIKRLDHIKIEKQ


>TTHERM_00470530(gene)
ATGTAGGGAGCCTCATAGTTATTAAACATTAGTGCAAGATCAAATGGATCTCAATTTATG
AGCAGCACTTTCTAAAGAGTCACCGCAAACATCCTCTGTTGTATGTGTGGTGTCTCCTTT
AATGCTGCCTAAACAAGAACAAATATGTGTGTTAATTGTTTAACCAATTAACAAGATATT
ACTACAGGAATTACTAAATAGGGAGTAGTTAATTTTTGTCGTATGTGCAGACGTTACAAC
AAACCACCTTGGGTTTATTGTGAACGTGAAAGCAAAGAAATGCTCTCTCTTTGTCTTAAG
AAGATTAAGGGTCTTGAGAAGGTTAAACTCATAGACAGTGCTTTCTTGTATACTGAACCC
CATTCTCGTCGTATTCGTATCCGTCTTACTATCTAAAAAGAAGTCATGAATAATACTTCT
ATCTAATAAAATTTTGTCGTTGAATTCGTAGAACACTACGGCTAGTGTGATGACTGTAAA
AAGGAATTTACTCCTCACACATGGGGTGCTTAAGTCTAACTTCGTTAAAAAGTTGAACAC
AAAAAGACTTTCTTCTTCTTAGAATAAGTTATGTTAAAGCATAATGCTCACGATAAAGTT
TTGAAAGTAGAAGAAAAGGATGATGGTTTAGATTTCTTCTATAAAAATAAAATGTAAGCA
AATCGTTTGGTAGACTTCATATAAAGTGTTATCCCCTGCAAGATTAAGCCTTCCAAACAG
CTTATCGGACTTGACGATCGTAACAATATTTACAATTACAAATATTCTTGGTCTGTTGAA
ATTCCTAAAATATGCAAGGATGACTTGTGTGTTTTCCCTCCTAGATTATGCAAAGAGTTA
GGAGGTATCAGTCCTCTTGTATTATGTGTTAAAGTTAGCAATATGCTCCATTTCGTAGAT
ACTCACACTCATAAGCGTATTGACATCACTGCTGAAAGATACTTCCATTATGAAAACGAC
ATTATTGTTCTCTCCTTAAAGAAAAACTCTACTGAATTTATGGTTACTGGTATTGAAAAA
ATTGAAAATGAATTTACTAATCCCTAAAGCTTGAATGAATCCTCTGTTAACACCAGTTAC
ATGTCTTCAATCAGCAACGTTTACTAAGATAAACTAGCTCACTTAACCCTCATGCGTACT
AGCGATTGGAAAGAATTCCATGCTAAAGCACATCTTGGTGAAATTATTAAGGAAGGATGC
ATGGTTTTGGGTTATGATTTGACAACATTGAACTACTCTGAAGACCTTGAAGTTCTTAAA
AATGCTCCTGAAATTATTATTGTCAAACGTATTTATGATAAGGAAAATAAAGCCCGTATT
TGGAAGCTTAAGCGTTTATAGATGGATGGTGTTATGGTTGAAGAAAATACCGAAGAAGCT
AATAAGAAGGGCAAGAAAAAAATAGTCTCAGACTAGGATAAAGAATAAGATTTTGAAGAG
TTTATGGATGACATAGAACGTGATCCTCTTATGCGTGAAAAAATTAATTTATATAAGGAT
GATGAAGGAATTAAAAAGCTCTCAGATAAGGAACTTGCAAGAAAGCAATAACTTTCCAGA
CGTCTTAAAAGAAAAATGCTTAAAGTTATTAACGTTAAAGTTAAAGATCCCTAAGAAATT
ATCAGATAACAAGAAGAAGAATTATAAGAGAAGCTTCGTATCGCAGAAGAAAAGAGGGCT
GAAAAGGAAGCTAAAAAGAAAGAAAAGGAAGACGAAGAAGACTACAACCGTAACGAAGTT
AAGTTGGCTGAATTATTAGAAGATCTTAATCTTGAAGAAGATAAAGGTGAAGAAGATGGA
GACAAAGTCTTTGATGAAGACAATTTCATTGACGAATTTATTAAAAGACTTGATCATATT
AAAATTGAAAAGTAATGA