Identifiers and Description

Gene Model Identifier

TTHERM_00442760

Standard Name

NMD2 (nonsense-mediated mRNA decay protein 2)

Aliases

PreTt05676 | 50.m00245 | 3681.m00104

Description

MIF4G domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00442760

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_12612.19.997093137033517e-262MIF4G domain-containing protei
n (1027 aa)
OxytrichaContig22006.0.g865.9981191891941984e-64MIF4G domain
WormBaseWBGene000048812.00017271388466e-38locus:smg-3 status:Confirmed
UniProt:C2BR97 protein_id
:CCD74194.1
DictyBaseDDB_G02816239.00381557957642e-37upf2 on chromosome: 3 position
4719332 to 4723605
SGDYHR077C2.0008113830639685e-30NMD2 Protein involved in the n
onsense-mediated mRNA decay (N
MD) pathway; interacts with Na
m7p and Upf3p; involved in tel
omere maintenance
Stentor CoeruleusSteCoe_102766.305116760146989e-16

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00442760(coding)
ATGGATAGCGAATAAATTCCTGAAGAAATTAAAAAATTTTTTGATGAAAGAGCTTAGTTA
TAGTCTTTTAGAAGATAGCTGAGATTGTAAAATATTAAGGCTAAGGAGAATTATGCTAAC
TTAAAAATGGATTAAAGAGTTTTAAAGCTTTAGTAAGTTACCAAGTTTCTCAATAAACTT
AAGGGAAGCAGACCTATGGATAGAGATGCTATTTTGAACGAAATAGATAACTATAATTTG
CAAAACTACATTAGCGAAATTACTATCTCAATTGCTGATTATAATATCACTGATAATGAT
ATTCTTTACTTTGTTTAGCTTTGTTCCAAACTTCATTAAAGTTATGAAGATTTCAACATA
CAAATGGTTATTTAGATTTAAAAGCAAATCAAAACAATTATCCCTTAAAAGGAAAAAGAT
GAAAAAGTTGTAGCAGTTAAAAGAAGAGACATGATGAGATTCATCGCTGAGCTCTTTGTT
GTAGGCGTTACAAGCTAATACGATAAAATGATGGAATGCTTAAAAGATATAATAAATCAT
AAAGAAGCTCGTCCTCTTATGTTAAATGTTTAAACAGCTTTAATGTTTTCTGACAGATTT
GGATTTGAAATTACTCGTCGCAAAGGCATTAAAATAAGTTTTAACTACAACAAGTATGAC
GATTTAGTCAATATCTTTGACTTTGATCAAATTGTTACACCTGAAAAAATATAAAAAATT
GTTATGTATTTCTAATATTATTTAAATATATTAATGGATCATCTGAAGAACCTCTACGAT
CTAAAAATTCAATAAGATGAAAAGCTAAATAAGCTAATAAGTGAAGAAAAGCTTACAGAA
AAAGATGAATAGGAATACACTAGAACAAGAAACAATTATATTAATTTATATGAAGCTCTT
TCTACTATTGCTGATAATCTAGAATTGGATTTTAAAGTAAACTTTGGAGAAGAAGAAAGA
GAAAAAAAATAACAAAAAATTCTAGAGGAGTAGAGGAGAAAGAAATTAGAAGAAGAAGAG
CGTCTTCGCTAAGAAAGTGAAAATTTATTTGACACTGATGAAGAAAGGGCATTCTATGAA
GATATATTTGACTTAAAGGTTAAGCTTCCTGGATCTCTTTTTTCCAATAATTACTTCTAA
GGAAATGTTTAAAAGACATCTGCAAACAATGAAAATGATGATGATTTAGATTAAGACAAT
GACAATGAAAAAGAATAAGAAGAGGAGGAGGAAGAAGAAAAAAAAGATGAAGAGGATGAA
GACAAAGATAATGATGATATTCCTAAGTCTTATGAGCAATTTAAAAAGAACTTAAAACAC
TGTGTCAGCTAAGAAAAGGCAGATTTATTAGCAGAATAGTTTGTATATGTTAACAATAAA
TAAAATAGAAAAAAATTAGTTAAAGACATTCTTGAATACAGAAAAGAATATAATTTGATG
GTTCCTCATTTGTGTAGATTTGTTGCTGTTATTAGCAAGCATTTTAAAGATTTGGGTGAT
ATGGTCGTAGAAAAATTAATTAAAGATTTTGACTCCTACAGAGAAAAGTAGAGACAAGAC
TTTTCTTTCAGAGATAAGAAAATGAGATATTTAAAATATTTATGTGAGCTAGCTAAATTT
AGAGTTTTAGAGCTTTTCAAAATTTTAAATATTTTTAAATCTCTTGTTGATGATTTTAAC
ACTTAATAAGTAGATTTACTTTGTGTTATCATGGATAATGTAGGTAGATTTATTTATAAT
AACTAAGAAACTCGTTTTAGATACATCACTATCCTTGACTAGCTTAACGTTCATCTTCGT
AAAGCTAATTTACCCACAAATAAGTCCATATAGCTTGAAAACTCTATCAGTCTATCCAAG
CCCTCAAAGAAAAAGGCAATTAAATCTGAAAAATAAAGAACTGAATTAGAGCAATATATT
AGATTTTTGGTTTTGGAAAAATTAAACGAAATGAGCTTCAGAGAAGTTACTGCTACTATC
TAAAAACTTAAATGGGATGAGTAGCTTGACGATTATTGCTTCAATGCTATCATTAAGAGA
GCTTTAAAGGGAAGAATAGATGATATATAGCTATGCGCTGGTTTACTCTCTTTCTTGAAT
ACATTTAGACCAACACTAACTCTTAGAATTGTAGATGATCTATTAGAAAAGACTATTTAT
GGAATGGAATAAAATGAAGTTTAGGAATAACAAAAAAGAATCAGTGTTGTGAGATTCTTA
GGAGAGTTATACTTATATTAAGTTGTTGAAATAGATTTTATTTTTGATTTGCTTTATCTA
TGTATTGATTTTGGTCATGAACCTTTTAGAACCTAAGAAGAAATCGAAAGAATTGATAGC
TAAGAGGATTTATTCAGAATTTCTATGATTTGCAATATCCTTGAACCTGTTAGATAATAT
ATCACAAAGAGACGCACATTCCCTAAAATGCTTAGATTCTTAATCTTTTTCCAAAGATAT
ATTCTCTCTAAGAAGTATGTTCCTATAGACATAGAATTCATGGTCCTAGATACTTTCGAA
AGTCTAGATTCAGGTAGCAGCAGATTGACAAAAATTAAAACTTACAATGATGCTAATGAG
CTTGTTAATTCTATAGAGTAAAAAGAGAAAAAAGGAACTCTGAAAACAGTGGAAGAAGAA
TTGAAAGTATTTTTGGGAAACCTTATTTTAAAAAATAATAAACTGTAAGATAATAATAAT
AACTCAACCCAAAATGATTAAAAATAAAATTAAACTAATAAAGCACCTAATGAAGAAGAA
CAAAAACTCAAAGCTATAAATCAATAATATGATGATGATATAGAAAGGGAACTCAATTCA
ATTATAAATCATGACACTTAAATTTAATCATAAATGTTAAATACAAAAAATGTAAACTAT
AAAAAGAAAATCATCAATGCTACTGCTAAAGTTAACATTCAAGATGATTCTGGATAGACT
AAAACCATCACAATTATTAAAAAGAAAAAAGATACATAAAAAAATGATATAACCAATATT
AATAATTTCATATATGGTCCTGATGGTTTAATTCAAAACGAACAAATTCAATTTAAAATG
CCTAAGACTAAAAAGAAATGA


>TTHERM_00442760(protein)
MDSEQIPEEIKKFFDERAQLQSFRRQLRLQNIKAKENYANLKMDQRVLKLQQVTKFLNKL
KGSRPMDRDAILNEIDNYNLQNYISEITISIADYNITDNDILYFVQLCSKLHQSYEDFNI
QMVIQIQKQIKTIIPQKEKDEKVVAVKRRDMMRFIAELFVVGVTSQYDKMMECLKDIINH
KEARPLMLNVQTALMFSDRFGFEITRRKGIKISFNYNKYDDLVNIFDFDQIVTPEKIQKI
VMYFQYYLNILMDHLKNLYDLKIQQDEKLNKLISEEKLTEKDEQEYTRTRNNYINLYEAL
STIADNLELDFKVNFGEEEREKKQQKILEEQRRKKLEEEERLRQESENLFDTDEERAFYE
DIFDLKVKLPGSLFSNNYFQGNVQKTSANNENDDDLDQDNDNEKEQEEEEEEEKKDEEDE
DKDNDDIPKSYEQFKKNLKHCVSQEKADLLAEQFVYVNNKQNRKKLVKDILEYRKEYNLM
VPHLCRFVAVISKHFKDLGDMVVEKLIKDFDSYREKQRQDFSFRDKKMRYLKYLCELAKF
RVLELFKILNIFKSLVDDFNTQQVDLLCVIMDNVGRFIYNNQETRFRYITILDQLNVHLR
KANLPTNKSIQLENSISLSKPSKKKAIKSEKQRTELEQYIRFLVLEKLNEMSFREVTATI
QKLKWDEQLDDYCFNAIIKRALKGRIDDIQLCAGLLSFLNTFRPTLTLRIVDDLLEKTIY
GMEQNEVQEQQKRISVVRFLGELYLYQVVEIDFIFDLLYLCIDFGHEPFRTQEEIERIDS
QEDLFRISMICNILEPVRQYITKRRTFPKMLRFLIFFQRYILSKKYVPIDIEFMVLDTFE
SLDSGSSRLTKIKTYNDANELVNSIEQKEKKGTLKTVEEELKVFLGNLILKNNKLQDNNN
NSTQNDQKQNQTNKAPNEEEQKLKAINQQYDDDIERELNSIINHDTQIQSQMLNTKNVNY
KKKIINATAKVNIQDDSGQTKTITIIKKKKDTQKNDITNINNFIYGPDGLIQNEQIQFKM
PKTKKK


>TTHERM_00442760(gene)
ATGGATAGCGAATAAATTCCTGAAGAAATTAAAAAATTTTTTGATGAAAGAGCTTAGTTA
TAGTCTTTTAGAAGATAGCTGAGATTGTAAAATATTAAGGCTAAGGAGAATTATGCTAGT
AAAGATTATTATGTTTCATCACTATTGAATATTAATATTATACATATATTTAAAAAGACT
TAAAAATGGATTAAAGAGTTTTAAAGCTTTAGTAAGTTACCAAGTTTCTCAATAAACTTA
AGGGAAGCAGACCTATGGATAGAGATGCTATTTTGAACGAAATAGATAACTATAATTTGC
AAAAGTATAACTTAAAAAATAATAAAATTTAATAGATGATTGATTGATTGTATCAATATT
TTTTCAATTTAGATTTTATTAAAAATGGATTTTTGAAGAATTAAAAAATTTATTTTAATA
TAATATAAATATAGCTACATTAGCGAAATTACTATCTCAATTGCTGATTATAATATCACT
GATAATGATATTCTTTACTTTGTTTAGGTATATTAATGAATATAAGTGTTTTTTATAGCT
TTAAATATAATACTTTTATATAAAAAAGCTTTGTTCCAAACTTCATTAAAGTTATGAAGA
TTTCAACATACAAATGGTTATTTAGATTTAAAAGCAAATCAAAACAATGTAAAATACATT
TTAGCTTATTGTTATGATCCTTAATAATCAAATATTGGAAATTTAGTATCCCTTAAAAGG
AAAAAGATGAAAAAGTTGTAGCAGTTAAAAGAAGAGACATGATGAGATTCATCGCTGAGC
TCTTTGTTGTAGGCGTTACAAGCTAATACGATAAAATGATGGAATGCTTAAAAGATATAG
TAAATATTTGTTTATTTAGAAAATAATAAAAGTACATACAATAATTATTTTGTAAAAAAA
AAGATAAATCATAAAGAAGCTCGTCCTCTTATGTTAAATGTTTAAACAGCTTTAATGTTT
TCTGACAGATTTGGATTTGAAATTACTCGTCGCAAAGGCATTAAAATAAGTTTTAACTAC
AACAAGTATGACGATTTAGTCAATATCTTTGACTTTGATCAAATTGTTACACCTGAAAAA
ATATAAAAAATTGTTATGTATTTCTAATATTATTTAAATATATTAATGGATCATCTGAAG
AACCTCTACGATGTAAGCGATATTTATTTTTAGGTATATAGATTATTAATCAAGCATCTT
TTAATCATTAGCTAAAAATTCAATAAGATGAAAAGCTAAATAAGCTAATAAGTGAAGAAA
AGCTTACAGAAAAAGATGAATAGGAATACACTAGAACAAGAAACAATTATATTAATTTAT
ATGAAGCTCTTTCTACTATTGCTGATAATCTAGAATTGGATTTTAAAGTAAACTTTGGAG
AAGAAGAAAGAGAAAAAAAATAACAAAAAATTCTAGAGGAGTAGAGGAGAAAGAAATTAG
AAGAAGAAGAGCGTCTTCGCTAAGAAAGTGAAAATTTATTTGACACTGATGAAGAAAGGG
CATTCTATGAAGATATATTTGACTTAAAGGTTAAGCTTCCTGGATCTCTTTTTTCCAATA
ATTACTTCTAAGGAAATGTTTAAAAGACATCTGCAAACAATGAAAATGATGATGATTTAG
ATTAAGACAATGACAATGAAAAAGAATAAGAAGAGGAGGAGGAAGAAGAAAAAAAAGATG
AAGAGGATGAAGACAAAGATAATGGTAAATATAAACTAATAAATAAATAAATAAAATCAC
TAAAGCTATAATTAATTAAATATTTTTTATTTGTAGATGATATTCCTAAGTCTTATGAGC
AATTTAAAAAGAACTTAAAACACTGTGTCAGCTAAGAAAAGGCAGATTTATTAGCAGAAT
AGTTTGTATATGTTAACAATAAATAAAATAGAAAAAAATTAGTTAAAGACATTCTTGAAT
ACAGAAAAGAATATAATTTGATGGTTCCTCATTTGTGTAGATTTGTTGCTGTTATTAGCA
AGCATTTTAAAGATTTGGGTGATATGGTCGTAGAAAAATTAATTAAAGATTTTGACTCCT
ACAGAGAAAAGTAGAGACAAGACTTTTCTTTCAGAGATAAGAAAATGAGATATTTAAAAT
ATTTATGTGAGCTAGCTAAATTTAGAGTTTTAGAGCTTTTCAAAATTTTAAATATTTTTA
AATCTCTTGTTGATGATTTTAACACTTAATAAGTAGATTTACTTTGTGTTATCATGGATA
ATGTAGGTAGATTTATTTATAATAACTAAGAAACTCGTTTTAGATACATCACTATCCTTG
ACTAGCTTAACGTTCATCTTCGTAAAGCTAATTTACCCACAAATAAGTCCATATAGCTTG
AAAACTCTATCAGTCTATCCAAGCCCTCAAAGAAAAAGGCAATTAAATCTGAAAAATAAA
GAACTGAATTAGAGCAATATATTAGATTTTTGGTTTTGGAAAAATTAAACGAAATGAGCT
TCAGAGAAGTTACTGCTACTATCTAAAAGTAATTAAAATTAATCAATTAATTTGTACTTT
CTATCTATGTTGACATATATAAAAAAAAAATTTTTATCAGTTTCATAACCTAATTTTAAT
TTTTAAAAAAGACTTAAATGGGATGAGTAGCTTGACGATTATTGCTTCAATGCTATCATT
AAGAGAGCTTTAAAGGGAAGAATAGATGATATATAGCTATGCGCTGGTTTACTCTCTTTC
TTGAATACATTTAGACCAACACTAACTCTTAGAATTGTAGATGATCTATTAGAAAAGGTA
AATTTTGTCAAAATTAGTAATAAAATTGTTAATTAATTATGAAATTAAATAGACTATTTA
TGGAATGGAATAAAATGAAGTTTAGGAATAACAAAAAAGAATCAGTGTTGTGAGATTCTT
AGGAGAGTTATACTTATATTAAGTTGTTGAAATAGATTTTATTTTTGATTTGCTTTATCT
ATGTATTGATTTTGGTCATGAACCTTTTAGAACCTAAGAAGAAATCGAAAGAATTGATAG
CTAAGAGGATTTATTCAGAATTTCTATGATTTGCAATATCCTTGAACCTGTTAGATAATA
TATCACAAAGAGACGCACATTCCCTAAAATGCTTAGATTCTTAATCTTTTTCCAAAGATA
TATTCTCTCTAAGAAGTATGTTCCTATAGACATAGAATTCATGGTCCTAGATACTTTCGA
AAGTCTAGATTCAGGTAGCAGCAGATTGACAAAAATTAAAACTTACAATGATGCTAATGA
GCTTGTTAATTCTATAGAGTAAAAAGAGAAAAAAGGAACTCTGAAAACAGTGGAAGAAGA
ATTGAAAGTATTTTTGGGAAACCTTATTTTAAAAAATAATAAACTGTAAGATAATAATAA
TAACTCAACCCAAAATGATTAAAAATAAAATTAAACTAATAAAGCACCTAATGAAGAAGA
ACAAAAACTCAAAGCTATAAATCAATAATATGATGATGATATAGAAAGGGAACTCAATTC
AATTATAAATGTAAAGATTAATTAAATCAAGTCTTATAAAATATTAACTTTAACAAATAA
TTTAAAAAGCATGACACTTAAATTTAATCATAAATGTTAAATACAAAAAATGTAAACTAT
AAAAAGAAAATCATCAATGCTACTGCTAAAGTTAACATTCAAGATGATTCTGGATAGACT
AAAACCATCACAATTATTAAAAAGAAAAAAGATGTAATTACACTTAATTATTTATTTTTT
TAAATTTTTAATTTTTATTTTTTAAATTTAGACATAAAAAAATGATATAACCAATATTAA
TAATTTCATATATGGTCCTGATGGTTTAATTCAAAACGAACAAATTCAATTTAAAATGCC
TAAGACTAAAAAGAAATGA