Identifiers and Description

Gene Model Identifier

TTHERM_01161020

Standard Name

NIT2 (NITrilase superfamily)

Aliases

PreTt26356 | 259.m00040 | 3823.m01241

Description

hydrolase, carbon-nitrogen family protein; NITrilase superfamily

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

  • hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds (IEA) | GO:0016810

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.9%

TetraMine Data

TTHERM_01161020

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10641.19.997093137033517e-262hydrolase, carbon-nitrogen fam
ily protein (289 aa)
OxytrichaContig5461.0.g469.99562814099401e-84Carbon-nitrogen hydrolase
DictyBaseDDB_G02735192.0008312485874125e-83nit1-2 on chromosome: 2 positi
on 3048030 to 3048905
WormBaseWBGene000035942.000299424410363e-74locus:nft-1 Nitrilase and fr
agile histidine triad fusion p
rotein NitFhit status:Confir
med UniProt:O76463 protein
_id:CAB60517.1
SGDYJL126W1.9992362000979228e-56NIT2 Nit protein, one of two p
roteins in S. cerevisiae with
similarity to the Nit domain o
f NitFhit from fly and worm an
d to the mouse and human Nit p
rotein which interacts with th
e Fhit tumor suppressor; nitri
lase superfamily member
Stentor CoeruleusSteCoe_141172.4426007377405277e-36

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01161020(coding)
ATGAATCAAATTAGAAAATGCTTAGTAGGTGTTGTTTAGATGTGTTCTACTCACAATAAA
AAATAAAATATGGAATTTATTCTTTAAAATTTAAAATAAGCTCATGAAAAATAAGCGAAA
ATATGCTTTTTTCCTGAAGCCTTTGCAATGATTTCTAGAAGTTTTGCAGAAACATTTGAA
AACGCAGAATATATTGATGGTGAAATGATAAATTGCTTAAGAGATCATGCTAAAAAGTAT
AATTTGTGGCTATCGCTTGGAGGCTTTTAGGAAAGATTAAAAGAAAATGATAAAAAGATG
GGAAATACTCATATCATTATTGATAATTTAGGAAACATAGTATAAACTTATAAGAAGCTT
CATCTTTTTGATATAAGCATCGACACAAAAAACACAATATCTGAAAGTAGTGGTTATGTA
TTTGGCGACTAAGTTCCAAATGTTGTTGACTCTCCTGCAGGCAGGTTAGGATTATCTATT
TGCTATGACTTGAGATTCCCTGAGCTTTTTAGACTTCTCGCAGTTCAACAGAAAGCTGAA
ATATTATTAGTTCCAAGTGCTTTTTTTAAAAAGACTGGCTAAGCTCACTGGCATACTCTA
CTAAAAGCTAGAGCCATAGAAAATTAATGCTTCGTTATTGCAGCTGCATAAGCAGGATAG
CATAATGATAAAAGAGAAAGCTATGGACACTCTTTAGTTATAGATCCTTGGGGTGAAGTA
TTATTGGATATGGGACCAGAAAAGCTTGGTATTGATTTTGTAGAAATAGATTTGGAAAAA
ATTGATACAGTCAGAAAAGGTTTACCAGCTATAAATCATATTAGAAACGATATTTACAAG
CTATCTAAAATTTGA


>TTHERM_01161020(protein)
MNQIRKCLVGVVQMCSTHNKKQNMEFILQNLKQAHEKQAKICFFPEAFAMISRSFAETFE
NAEYIDGEMINCLRDHAKKYNLWLSLGGFQERLKENDKKMGNTHIIIDNLGNIVQTYKKL
HLFDISIDTKNTISESSGYVFGDQVPNVVDSPAGRLGLSICYDLRFPELFRLLAVQQKAE
ILLVPSAFFKKTGQAHWHTLLKARAIENQCFVIAAAQAGQHNDKRESYGHSLVIDPWGEV
LLDMGPEKLGIDFVEIDLEKIDTVRKGLPAINHIRNDIYKLSKI


>TTHERM_01161020(gene)
ATGAATCAAATTAGAAAATGCTTAGTAGGTGTTGTTTAGATGTGTTCTACTCACAATAAA
AAATAAAATATGGAATTTATTCTTTAAAATTTAAAATAAGCTCATGAAAAATAAGCGAAA
ATATGCTTTTTTCCTGAAGCCTTTGCAATGATTTCTAGAAGTTTTGCAGAAACATTTGAA
AACGCAGAATATATTGATGGTGAAATGATAAATTGCTTAAGAGATCATGCTAAAAAGTAT
AATTTGTGGCTATCGCTTGGAGGCTTTTAGGAAAGATTAAAAGAAAATGATAAAAAGATG
GGAAATACTCATATCATTATTGATAATTTAGGAAACATAGTATAAACTTATAAGAAGCTT
CATCTTTTTGATATAAGCATCGACACAAAAAACACAATATCTGAAAGTAGTGGTTATGTA
TTTGGCGACTAAGTTCCAAATGTTGTTGACTCTCCTGCAGGCAGGTTAGGATTATCTATT
TGCTATGACTTGAGATTCCCTGAGCTTTTTAGACTTCTCGCAGTTCAACAGAAAGCTGAA
ATATTATTAGTTCCAAGTGCTTTTTTTAAAAAGACTGGCTAAGCTCACTGGCATACTCTA
CTAAAAGCTAGAGCCATAGAAAATTAATGCTTCGTTATTGCAGCTGCATAAGCAGGATAG
CATAATGATAAAAGAGAAAGCTATGGACACTCTTTAGTTATAGATCCTTGGGGTGAAGTA
TTATTGGATATGGGACCAGAAAAGCTTGGTATTGATTTTGTAGAAATAGATTTGGAAAAA
ATTGATACAGTCAGAAAAGGTTTACCAGCTATAAATCATATTAGAAACGATATTTACAAG
CTATCTAAAATTTGA