Identifiers and Description

Gene Model Identifier

TTHERM_00590240

Standard Name

NIP7 (60S ribosome subunit biogenesis protein NIP7)

Aliases

PreTt24138 | 81.m00195 | 3726.m00071

Description

60S ribosome subunit biogenesis protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF01472 ) PUA domain
  • ( PF03657 ) Uncharacterised protein family (UPF0113)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00590240

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16968.19.998173848842182e-13460S ribosome subunit biogenesi
s protein (189 aa)
OxytrichaContig10478.0.g261.9993206333383003e-80Uncharacterised protein family
(UPF0113)
SGDYPL211W2.0001503375893664e-79NIP7 Nucleolar protein require
d for 60S ribosome subunit bio
genesis, constituent of 66S pr
e-ribosomal particles; physica
lly interacts with Nop8p and t
he exosome subunit Rrp43p
DictyBaseDDB_G02954775.997225115851065e-74nip7 on chromosome: 2 position
615393 to 616101
WormBaseWBGene000166074.997593565024277e-7060S ribosome subunit biogenesi
s protein NIP7 homolog statu
s:Confirmed UniProt:P91154
protein_id:CCD65161.1
Stentor CoeruleusSteCoe_182717.281290178321643e-33

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00590240(coding)
ATGAGATTATTAACTGACGAAGAAACTAAAGTCTTTTTCACTAAGCTTTCAGAATACATT
GGCCCAAACATTAAATTCTTAATCGATAGAACTGATGAACCTCACGTTTTCCGTCTTGTA
AAAGATCGTGTTTATTACATGAGTGAATCAATTATGAAATAAGCTCAAAATATTGGCAGA
GACTAGTTGATGCACGCTGGTACATGCTTTGGTAAATTCACTAAGGGTGGAAAATTCAGA
TTGAGCATCACTTGTTTAGATTATTTAGCCAAGTTTGCCAAGAATAAAGTCTGGCTCAAA
CCTTAGGGTGAACAATCTTACTGTTACGGTAACCACGTTATTAAGGCCCACGTAGGTAGA
ATGACTGAAAATATAGTTTAATACGCTGGTGTTGTTATTTTCTCTATGAATGACATGCCT
CTTGGTTTTGGTATTGCTGCCAGGGGTACTCTTTAAGCCAAGGATATGGATCCTACTGGT
GTTGTTGTTTTCAATCAAAGTGATGTGGGTGAATATTTACGTAACGAAGACGAAGAAAGA
TCTGCTGCTTAATAAAATCAATAATAGTGA


>TTHERM_00590240(protein)
MRLLTDEETKVFFTKLSEYIGPNIKFLIDRTDEPHVFRLVKDRVYYMSESIMKQAQNIGR
DQLMHAGTCFGKFTKGGKFRLSITCLDYLAKFAKNKVWLKPQGEQSYCYGNHVIKAHVGR
MTENIVQYAGVVIFSMNDMPLGFGIAARGTLQAKDMDPTGVVVFNQSDVGEYLRNEDEER
SAAQQNQQQ


>TTHERM_00590240(gene)
ATGAGATTATTAACTGACGAAGAAACTAAAGTCTTTTTCACTAAGCTTTCAGAATACATT
GGCCCAAACATTAAATTCTTAATCGATAGAACTGATGAACCTCACGTTTTCCGTCTTGTA
AAAGATCGTGTTTATTACATGAGTGAATCAATTATGAAATAAGCTCAAAATATTGGCAGA
GACTAGTTGATGCAGTAATTTTTTATAAATTTTTTCATTTAAATTTTATCCTTAGTTATC
ACTCTAGCAAATAATCTACATTTTTTGTCAATAAATGGCTAAATTGTCAATTATTGAAAA
TAAAAAAAGCACTTTAATTTTAATTAAGAGCAAGCAAGCAATAACATCTAATTCTACTTT
GAGAATTTTACAAATCTTTATGATAATTAATGTCAAAATGTATTAATAAATTATTATTTA
CTACTAATTAGCGCTGGTACATGCTTTGGTAAATTCACTAAGGGTGGAAAATTCAGATTG
AGCATCACTTGTTTAGATTATTTAGCCAAGTTTGCCAAGAATAAAGTCTGGCTCAAACCT
TAGGGTGAACAATCTTACTGTTACGGTAACCACGTTATTAAGGCCCACGTAGGTAGAATG
ACTGAAAATATAGTTTAATACGCTGGTGTTGTTATTTTCTCTATGAATGACATGCCTCTT
GGTTTTGGTATTGCTGCCAGGGGTACTCTTTAAGCCAAGGATATGGATCCTACTGGTGTT
GTTGTTTTCAATCAAAGTGATGTGGGTGAATATTTACGTAACGAAGACGAAGAAAGATCT
GCTGCTTAATAAAATCAATAATAGTGA