Identifiers and Description

Gene Model Identifier

TTHERM_00621280

Standard Name

NHX2 (Sodium Hydrogen Exchanger 2)

Aliases

PreTt05125 | 86.m00157

Description

Sodium/hydrogen exchanger family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( TIGR00831 ) Na+/H+ antiporter
  • ( TIGR03173 ) xanthine permease
  • ( PF03647 ) Transmembrane proteins 14C
  • ( PF02322 ) cytochrome oxidase subunit II
  • ( TIGR00840 ) sodium/hydrogen exchanger 3
  • ( TIGR02831 ) stage II sporulation protein M
  • ( PF07690 ) transporter, major facilitator family
  • ( PF00999 ) transporter, monovalent cation:proton antiporter-2 (CPA2)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00621280

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03058.19.997093137033517e-262Ulp1 protease family, C-termin
al catalytic domain-containing
protein (597 aa)
OxytrichaContig14635.0.g923.999498296699862e-96Sodium/hydrogen exchanger fami
ly
WormBaseWBGene000037352.999661265281073e-47locus:nhx-8 Sodium/hydrogen
exchanger status:Confirmed
UniProt:G5EFN1 protein_id:C
AD36499.1
SGDYDR456W5.997418848378574e-45NHX1 Na+/H+ and K+/H+ exchange
r, required for intracellular
sequestration of Na+ and K+; l
ocated in the vacuole and late
endosome compartments; requir
ed for osmotolerance to acute
hypertonic shock and for vacuo
lar fusion
DictyBaseDDB_G02757115.998886722426197e-42nhe1 on chromosome: 2 position
6042281 to 6044641
Stentor CoeruleusSteCoe_338461.3336148155022614e-34

General Information

Paragraph NoGene NameParagraph Text
26NHX2NHX2 belongs in the family of sodium-hydrogen exchangers that act as antiporrters that maintain the pH of actively metabolizing cells by controlling the balance of sodium. THe antiporters have 10-12 regions on the N-terminus and a large cytoplasmic region on the C-terminus. The 10-12 transmembrane regions contain 2 highly conserved regions and most of the regions share identities within the family , while the large cytoplasmic region is noted to have little similarity with other members in the family. Paragraph by: Chris Fang and Deanna Liou (undergraduates) Keck Science Department, The Claremont Colleges

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00621280(coding)
ATGTTTGGAGTAATCTTTTTAATTGTAGTTGTGCTAATCTTGTTCTATTTGATTGGAGGT
GGGCTCCTTGAGCACTATAAGATACACGTTATTCATGAAACAGGATTAGGTATCATTATG
GGTATGATTGTAGGATTTATTTTCTATCAAGCCGATTACGAATTCTACTCAAGTAGTATG
ATATTTGAAGGTGAGCTCTTCTTTTACTTTATCCTTCCACCCATTATTTTTGCAGGCGGT
TACAACTTGAAAAAGCGTCGTTTTTTCCAAAATTTCTTCTACATTAATATATATGGATTA
CTTGGTACTATAGTCAATTTCATAGTAGTATGGCTCTTAACTTATGCTGTTAACGAAGCA
GGTTTGATTCGTAGATATAGTGATTTTTCTCAGTCTGTAACATTATCAACAAGAGATATC
CTTCTGTTTTCTGCTACTATATGCGCTACAGATAGTGTAGCTGCCTTAGCTATGATTAAA
TCAGAGAAATATCCAAAATTATTTAGTGTTATTTTTGGTGAAGGCATGGTAAATGATTCT
GTATCAATTATTCTATATAAGGCTGTCTTGGATTTAGTTGGCGACTCATCTGAACCTCAG
CCTATAACTTTCACTTTCCTTAACTTCTTAAAGATGATTGGTGAATTCCTTAAAAACTCA
GTATGCAGTTTAGCTATTGGTCTTGGTTGGGGTCTCTTAGCTACTTTAGTCATGAAAAAA
TTTAGGTTTTTGACACATAATCCAGTAGTTGAAACAGTTGTTGTTTTACTATTTGGTTTT
GGTGCTTTCGCTTCTTCAGAAAACCTAGATATGTCTGGTGTCATTTCAATTTTAGTATGT
GGTATTATCATGTCTCATTACCTTTTCTATAACATATCATCAACTGGTAAAGTAACAACA
GGTGTCACTTTTTCAAGTATCTCTATTATTGCAGAATCAGCTCTTTATATCTATTTGGGT
ATCGTCTTCTGGTAAACAAAGGGAGATCCTCACAATCCAAGCTCTTATGCATGGTCATGG
ACTTTCTTACTCATTGAATTGGCTATTGCCTTTTTCGCTCGTTTTGTGAGTGTTTTTGTA
GTTTCTTGGATTTTCATGCTAATTAAGGGCAAATAAAAATGGAGATTAAATAGATATGAA
ATGGGTATTATTTGGTTTGCAGGTATTATTAGAGGAGCTATTGCTTTTGCATTGATTTAG
AATGTACCTTAAGATGATTCAAATCCTTAGGCAACACAAGTTATTTAGAGTACAACTCTC
TTTATTGTTATAATCACAACTATTGTCTTAGGAGGTCTAATGCCTTTTTATATAAATGTC
ATGCTGAAACAAATTTCAAAGAATCCTAAGTATCATGAAAATCATCCTTCTATTCGTGAT
AGTTTGGTTGGAGAATCAAAAGAAAGTAGAGAATTCAAAAGCAAGAGTCAGACAAAGTGG
AAATTATTTGATGAAAACTTTATCAAACCTTTGTTCATTTTCGACTATGAAAATAGAAAA
GAGCAAATTAAGATGGAAAAACAAAAGCTTAAAATGAACAGCTCACAGTTTGATGCTGGA
TATATAAAAGAATAGGAATAGGAAATGGGTCACCAAGAAAACGAAAATGAAGAAAATCAT
CAAGATTAACAAGATCAACAGCAACAAGAATTGCAAATTGGAAATGATAATGGCTAAGAA
GAAAATTTCAAATAAATATCCAGAGCAAACATGAATAAGCAAGCAGTTTAATCAATCAAT
TAAGATCCAGAAAATCATAGTAGTAATGAACATATTTGA


>TTHERM_00621280(protein)
MFGVIFLIVVVLILFYLIGGGLLEHYKIHVIHETGLGIIMGMIVGFIFYQADYEFYSSSM
IFEGELFFYFILPPIIFAGGYNLKKRRFFQNFFYINIYGLLGTIVNFIVVWLLTYAVNEA
GLIRRYSDFSQSVTLSTRDILLFSATICATDSVAALAMIKSEKYPKLFSVIFGEGMVNDS
VSIILYKAVLDLVGDSSEPQPITFTFLNFLKMIGEFLKNSVCSLAIGLGWGLLATLVMKK
FRFLTHNPVVETVVVLLFGFGAFASSENLDMSGVISILVCGIIMSHYLFYNISSTGKVTT
GVTFSSISIIAESALYIYLGIVFWQTKGDPHNPSSYAWSWTFLLIELAIAFFARFVSVFV
VSWIFMLIKGKQKWRLNRYEMGIIWFAGIIRGAIAFALIQNVPQDDSNPQATQVIQSTTL
FIVIITTIVLGGLMPFYINVMLKQISKNPKYHENHPSIRDSLVGESKESREFKSKSQTKW
KLFDENFIKPLFIFDYENRKEQIKMEKQKLKMNSSQFDAGYIKEQEQEMGHQENENEENH
QDQQDQQQQELQIGNDNGQEENFKQISRANMNKQAVQSINQDPENHSSNEHI


>TTHERM_00621280(gene)
ATGTTTGGAGTAATCTTTTTAATTGTAGTTGTGCTAATCTTGTTCTATTTGATTGGAGGT
GGGCTCCTTGAGCACTATAAGGTAATTGATTTTAATTCTCCATATATTTACATCTAAGAC
GAATTGGATAAAACCAGATAAATTTGAATTAATTGTTTACTAATTTAATTTTATAATATA
TTATAGATACACGTTATTCATGAAACAGGATTAGGTATCATTATGGGTATGATTGTAGGA
TTTATTTTCTATCAAGCCGATTACGAATTCTACTCAAGTAGTGTAAACAATAATAAAATT
GATTAAAAATGATTAAATTAGCAATTTAAAAAGAGTAACAACACCAAATTAACTAAAATT
ATTTTTAATTTAAATTAGATGATATTTGAAGGTGAGCTCTTCTTTTACTTTATCCTTCCA
CCCATTATTTTTGCAGGCGGTTACAACTTGAAAAAGCGTCGTTTTTTCCAAAATTTCTTC
TACATTAATATATATGGATTACTTGGTACTATAGTCAATTTCATAGTAGTATGGCTCTTA
ACTTATGCTGTTAACGAAGCAGGTAAAAAATAATTATTATTTAGTAGCATTTTACAGTAG
AAAATCTTAAATAAATTGCACTTAGCAATAAAATTCAATTGAATTATAAATAGCTAGTGG
ATGTTTATTACATTTAAGCATACTTTAAGTACAGAGTAAACAACCTTCAGCAAAGAAAAT
ACAGGCTCAAAAATAAAAATAAAATTTCTATGAATTAAATTTATATTATATTATCAAAAA
CTCAAAAAATGAATTTACAAATTTAATTAACACTATTTTTGTAATAAAAAGGTTTGATTC
GTAGATATAGTGATTTTTCTCAGTCTGTAACATTATCAACAAGAGATATCCTTCTGTTTT
CTGCTACTATATGCGCTACAGATAGTGTAGCTGCCTTAGCTATGATTAAATCAGAGAAAT
ATCCAAAATTATTTAGTGTTATTTTTGGTGAAGGCATGGTAAATGATTCTGTATCAATTA
TTCTATATAAGGCTGTCTTGGATTTAGTTGGCGACTCATCTGAACCTCAGCCTATAACTT
TCACTTTCCTTAACTTCTTAAAGATGATTGGTGAATTCCTTAAAAACTCAGTATGCAGTT
TAGCTATTGGTCTTGGTTGGGGTAAATAAAATTAAATTTAAATGGTTTAATTTACTAACT
ATTTTTTATAATTAAAAATAAATAGGTCTCTTAGCTACTTTAGTCATGAAAAAATTTAGG
TTTTTGACACATAATCCAGTAGTTGAAACAGTTGTTGTTTTACTATTTGGTTTTGGTGCT
TTCGCTTCTTCAGAAAACCTAGATATGTCTGGTGTCATTTCAATTTTAGTATGTGGTATT
ATCATGTCTCATTACCTTTTCTATAACATATCATCAACTGGTAAAGTAACAACAGGGTAA
TTTTTAGAAATTTTATAAAATATTAAGCTTAATTTTTTTGTTACTCTCTAAATTATTTGG
TTATATTCTTTAAAATAAACATAAATTTCTTTATATAAATTAATAGTGTCACTTTTTCAA
GTATCTCTATTATTGCAGAATCAGCTCTTTATATCTATTTGGGTATCGTCTTCTGGTAAA
CAAAGGGAGATCCTCACAATCCAAGCTCTTATGCATGGTCATGGACTTTCTTACTCATTG
AATTGGCTATTGCCTTTTTCGCTCGTTTTGTGAGTGTTTTTGTAGTTTCTTGGATTTTCA
TGCTGTAAAAAATTTTAATATGAATAAAAAAAAATATTTAAAAATTATATATTTTAATAG
AATTAAGGGCAAATAAAAATGGAGATTAAATAGATATGAAATGGGTATTATTTGGTTTGC
AGGTATTATTAGAGGAGCTATTGCTTTTGCATTGATTTAGAATGTACCTTAAGATGATTC
AAATCCTTAGGCAACACAAGTTATTTAGAGTACAACTCTCTTTATTGTTATAATCACAAC
TATTGTCTTAGGAGGTCTAATGCCTTTTTATATAAATGTCATGCTGAAACAAATTTCAAA
GAATCCTAAGTATCATGAAAATCATCCTTCTATTCGTGATAGTTTGGTTGGAGAATCAAA
AGAAAGTAGAGAATTCAAAAGCAAGAGTCAGACAAAGTGGAAATTATTTGATGAAAACTT
TATCAAACCTTTGTTCATTTTCGACTATGAAAATAGAAAAGAGCAAATTAAGATGGAAAA
ACAAAAGCTTAAAATGAACAGCTCACAGTTTGATGCTGGATATATAAAAGAATAGGAATA
GGAAATGGGTCACCAAGAAAACGAAAATGAAGAAAATCATCAAGATTAACAAGATCAACA
GCAACAAGAATTGCAAATTGGAAATGATAATGGCTAAGAAGAAAATTTCAAATAAATATC
CAGAGCAAACATGAATAAGCAAGCAGTTTAATCAATCAATTAAGATCCAGAAAATCATAG
TAGTAATGAACATATTTGA