Identifiers and Description

Gene Model Identifier

TTHERM_00316310

Standard Name

NHX1 (Sodium Hydrogen Exchanger 1)

Aliases

PreTt20942 | 31.m00244 | 3687.m00046

Description

Sodium/hydrogen exchanger family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( TIGR00831 ) Na+/H+ antiporter
  • ( PF03023 ) Virulence factor MVIN
  • ( TIGR00840 ) sodium/hydrogen exchanger 3
  • ( PF02378 ) Phosphotransferase system, EIIC
  • ( PF00027 ) cyclic nucleotide-binding domain
  • ( PF08946 ) Osmosensory transporter coiled coil
  • ( PF07674 ) Protein of unknown function (DUF1603)
  • ( PF07690 ) transporter, major facilitator family
  • ( PF06790 ) Uncharacterised protein family (UPF0259)
  • ( PF03547 ) transporter, auxin efflux carrier (AEC)
  • ( PF00999 ) transporter, monovalent cation:proton antiporter-2 (CPA2)
  • ( TIGR01726 ) amino ABC transporter, permease protein,

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00316310

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_08453.19.997093137033517e-262sodium/hydrogen exchanger fami
ly protein (1141 aa)
Stentor CoeruleusSteCoe_172292.820770088460135e-53
WormBaseWBGene000039439.002093297142233e-23locus:pbo-4 Na(+)/H(+) excha
nger protein 7 status:Confir
med UniProt:G5EBK1 protein
_id:CAA91995.2
OxytrichaContig16604.0.g632.0002795641672355e-21Sodium/hydrogen exchanger fami
ly
DictyBaseDDB_G02757118.99902975825788e-19nhe1 on chromosome: 2 position
6042281 to 6044641
SGDYDR456W0.000000000000006999063783600386NHX1 Na+/H+ and K+/H+ exchange
r, required for intracellular
sequestration of Na+ and K+; l
ocated in the vacuole and late
endosome compartments; requir
ed for osmotolerance to acute
hypertonic shock and for vacuo
lar fusion

General Information

Paragraph NoGene NameParagraph Text
25NHX1NHX1 is an integral membrane protein that shares homology with other proteins containing a sodium hydrogen exchanger domain involved in transporting sodium and hydrogen ions across the concentration gradient between a cell and its surroundings. Functioning as an antiporter for sodium and hydrogen ions, the exchange function characteristic of this domain is highly dependent on pH. Although the exact molecular mechanisms responsible for this behavior are not well understood, a prominent current inference is that these exchanger proteins use ATP to transport ions across membranes. Paragraph by: Samuel Rubin and Owen Foster (undergraduates) Keck Science Deparment, Claremont Colleges

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00316310(coding)
ATGAACAATAGCACTGACACTTCAGCTGCTACATATTAGCCTAATTATTTTAGTACAATG
GCAGCATAAGCCATAGATGATTCAAAAATTAGTACAGAATCGCTTGTAGTGTTTTTCCTT
TTTGGAGGACTTATGATTGCAGGTTTTGTTAGGGAAATTAATAAAAAAACTAGCATTCCT
TACACTCCAATGCTTTTTGTTATTGGAATTTTTTTAGGAAAGTTTTCTGAAAGCATGGGA
ATACTAGGAATAACAATAAGCAAGATAAGTTTAATCAACCCTCATGGTATATTAATTATA
TTCCTCCCTGTGCTTATTTTCGAAAGTGGTTTTAATAGTGATTGGCATACTTTTAAAAAG
TAATCTGGCCAGATATTTTTACTTGCCTTCCCATGTGTACTATTTTCAGCCATATTTTTA
CTCATAAGTATCAAAGTTATTTTGAGATATGATGACTCTTATTACACTTGGAGTGGTGCA
TTTATGTTCGGTTCTATTCTCTCATGTACAGATACAGTAGCCGTCCTAGCTCTTTTAAAA
GAAGTAGGCGCTCCTAAAAAATTTAATTCGCTGATTGAAGGAGAATCATTACTTAACGAT
GGTACCTGTATGGTTCTTTTCCAAATATCAAGTGAATTCGCAAAAAAAGTTGATTAGAAT
ACATAAAATCAGTAATATTTTGATTTGTTTGAAGTGATCAAACTTTTGCTTTCTCTCACT
GTTGGTGGTACACTTCTCGGTATTGTTTTTGGCATGATAGCCTAGTTTTGGATGCGTAGA
ATACATAATGATCCGATATTGACAGTCAATATAACCTTCATTGTTTGCTATCTAACTTAC
TATGTAGCAGAAAATGTAGATATTGGAATAAAAGTCTCAGGAATTATGGCTCTAGTTTCT
CTTGGTATTTATCTCTCTATATTTGGTAAAACTAAAATTTCAAGTGAAGAAAAGAGAACT
GTTTATATTTTCTGGAAGTACGTAACTTATGCTGGTGAATCAATTATTTTTATATTAGCT
GGTGTATTAGTTGGTGTTAAAGTTTTAACATCTAATGGGGATTACGACACTATGTCAGGA
AGCGATAATGTTTCTTCTTCAATTTAAACTAGTGATTATTTTAAACTTTTTGGTCTTTAC
GTTTGTATGATCTTGAGTCGCTTTGGTAGTATTGCTTGCTTTATGTCTTGGTTGAGAAAA
TGGGGTTATGGTCTTACTTGGAAGGAAGTTTATGTCCTTGCTTACGGTGGTCTTAGAGGA
GCTATTGGTATTTCTTTTGCAATGATTGTTGCTAATGATGACTCTTACTCTCAAAAATTA
AGAGATATTATTTTATTCGATATGGCTGGAAATGCAATTTTAACATTAATTATCAATGGA
ACAACTACTGGTCCTTTGATTAAGAGTTTAGGATTATGCGTTACAAGCACAGTTAGAGAA
AGAGTCTTTTTAAATATTTTACAAGATTTGAAGGAAGATACTGAAAAAAAGATTAATTAT
TTGAAATCTAATAACTATCTAAAGATGGTCAATTGGGATAGTGTTAAAGAATATGTAGGA
TTAGCAGATTTGGAGCAAAGAATTACAAGATTAGAGTCAGATCTAACTAAAAGAGAAGAA
ATTGAAGAGTATACAAGAAATATAAGAAATAAAAATGTAATTGATGCTAAGATAGATGAA
CTTAAAAACTCTAATGAATTTTAAGAGTAGTAATCATTTGACTCAGATTCAACAAATCAC
AATCTTGATGAAAATATGATAGTTGAATGTAGAAATAGATTTTTGATGGCTCTCAAAGGA
AATTATTGGGATATTTATGAAAGAAATCAGTGCAGCAGTAATGCTTTATTATTGTTGATT
GATTCAGTAAATTGGGATCTGGATACTGAATAAGAAAGAATGAACTCATGGGAATTTCTT
TCCAATTACTTTTACAATCCTATTTACATCAAAGTGCTCTTTTAATTAAAAGGATGGCCT
ATTGTTGGATCTTATGCTGGTAACCTCCTCTTTAACCATATCTCTAATATTTATGATGTC
ATTGCTGCTTATATTGAAGCTCATGAACAAGCTGAGCAACTTTGCATAGATCAATTCCCT
TTCATTCCCTAAGTTTTAGAAATTATTATCAGAGAAAGCTAAGATAATAGAATGAGTGGC
GAAGAGTATATCAAAAATGATTTAAATGTAAGTTTCCCAGAAATTACTAAACAAATCCAA
ACTAAGAAGGCAACCTACAGTTTATTAGAGTGCTAAAAGAAAATAATAAAGAAGGGTATT
TTGTTAGGTAAGATAGATGAAAAAGAAAGAGATATATTAATGTAATAAATCGATGATAGA
GTAGTTGCTTTAGACAACATCAAACCTTCTTGGAAAGCTCCTCCAATCAAAAATTTCTTA
GAAAATGTTCCATTCTTTAAACTCATCCACAAAGATTTACTTCCATACATCATCAAAGAA
TCTGTTGAGATGATTTTTGAAAAAGATATGTACATCATCAAAGAAGGTGAGAAAGCTAAA
TACTTTTTTGTTATCACTAGAGGTAGTGCTACAGAAACAACATCTTAGAGCTTTTGCACA
TATCAAGAATAAAAGGAAGTTGGCAGTTTAATTTCTCCTCACCACTTGATTGTACCAAGT
TTGAGATACTTGACTTCCTGCATGGCTAATGCAGTTGTATACGTTCTTGCTTTCCCTTTA
AGCTCAATTTAGAAAGTTATCAAAGTTAATTTAGAAATAAAGGAATATGTTTGGATGTAG
AGTCTGAGAGCATTGAGTTAGCTTTTCTATAATGAACTTAAACCTTTAGGAAGTTTAGAT
AGAAACAGTTTTATTAAACTTCAACCAAAGTTGAAATTTGCTAAATATAACAAAGGGAAG
ACTATCTAGTGTGAAAGTGGTGGTATTCTTTTGAAAGGACAAGTTTCGAGAAAGGATTTA
ACAGATGTGATGATGACATAATCTAAAGTAAATAATGACGAGGTAAAAAAATCAGATTTG
ATTGATGGTAGAATTTATAAGGCATTTTGTGTTTTAATGCCAGGATAAGCTTTTTCAGTT
TTCACAGAAAAGAAGTGTACATTTTTGCACTTTGCTGAAGACTGTGAAGAAATTAGGTTT
ATGATTAGTCATATGGACTACAATGTTGGCATTAATTAGTAAACACCTCATACTCTTAAC
ATATTTAGTCCTGTAGCTGTTTCTGGATCTCATAATAAGAGAAACAGTTTTTAAGCTCCC
CACTTAAGTAGATTTGCAGGTAGACATACTTTTAATAATTTAGAAGTAGTTGTGCAAGGT
AGTGAAAATAAAATAAATTCAGGATAATAAATAGAATTGCAAAAGATGAAATCTAAATCA
TACTTAAACGACTAACAAATAAAGAGTGTAAAGAGTGATGATGAAGAATCAGATGATAAT
AAAGAAAAGTGA


>TTHERM_00316310(protein)
MNNSTDTSAATYQPNYFSTMAAQAIDDSKISTESLVVFFLFGGLMIAGFVREINKKTSIP
YTPMLFVIGIFLGKFSESMGILGITISKISLINPHGILIIFLPVLIFESGFNSDWHTFKK
QSGQIFLLAFPCVLFSAIFLLISIKVILRYDDSYYTWSGAFMFGSILSCTDTVAVLALLK
EVGAPKKFNSLIEGESLLNDGTCMVLFQISSEFAKKVDQNTQNQQYFDLFEVIKLLLSLT
VGGTLLGIVFGMIAQFWMRRIHNDPILTVNITFIVCYLTYYVAENVDIGIKVSGIMALVS
LGIYLSIFGKTKISSEEKRTVYIFWKYVTYAGESIIFILAGVLVGVKVLTSNGDYDTMSG
SDNVSSSIQTSDYFKLFGLYVCMILSRFGSIACFMSWLRKWGYGLTWKEVYVLAYGGLRG
AIGISFAMIVANDDSYSQKLRDIILFDMAGNAILTLIINGTTTGPLIKSLGLCVTSTVRE
RVFLNILQDLKEDTEKKINYLKSNNYLKMVNWDSVKEYVGLADLEQRITRLESDLTKREE
IEEYTRNIRNKNVIDAKIDELKNSNEFQEQQSFDSDSTNHNLDENMIVECRNRFLMALKG
NYWDIYERNQCSSNALLLLIDSVNWDLDTEQERMNSWEFLSNYFYNPIYIKVLFQLKGWP
IVGSYAGNLLFNHISNIYDVIAAYIEAHEQAEQLCIDQFPFIPQVLEIIIRESQDNRMSG
EEYIKNDLNVSFPEITKQIQTKKATYSLLECQKKIIKKGILLGKIDEKERDILMQQIDDR
VVALDNIKPSWKAPPIKNFLENVPFFKLIHKDLLPYIIKESVEMIFEKDMYIIKEGEKAK
YFFVITRGSATETTSQSFCTYQEQKEVGSLISPHHLIVPSLRYLTSCMANAVVYVLAFPL
SSIQKVIKVNLEIKEYVWMQSLRALSQLFYNELKPLGSLDRNSFIKLQPKLKFAKYNKGK
TIQCESGGILLKGQVSRKDLTDVMMTQSKVNNDEVKKSDLIDGRIYKAFCVLMPGQAFSV
FTEKKCTFLHFAEDCEEIRFMISHMDYNVGINQQTPHTLNIFSPVAVSGSHNKRNSFQAP
HLSRFAGRHTFNNLEVVVQGSENKINSGQQIELQKMKSKSYLNDQQIKSVKSDDEESDDN
KEK


>TTHERM_00316310(gene)
ATGAACAATAGCACTGACACTTCAGCTGCTACATATTAGCCTAATTATTTTAGTACAATG
GCAGCATAAGCCATAGATGATTCAAAAATTAGTACAGAATCGCTTGTAGTGTTTTTCCTT
TTTGGAGGACTTATGATTGCAGGTTTTGTTAGGGAAATTAATAAAAAAACTAGCATTCCT
TACACTCCAATGCTTTTTGTTATTGGAATTTTTTTAGGAAAGTTTTCTGAAAGCATGGGA
ATACTAGGAATAACAATAAGCAAGATAAGTTTAATCAACCCTCATGGTATATTAATTATA
TTCCTCCCTGTGCTTATTTTCGAAAGTGGTTTTAATAGTGATTGGCATACTTTTAAAAAG
TAATCTGGCCAGATATTTTTACTTGCCTTCCCATGTGTACTATTTTCAGCCATATTTTTA
CTCATAAGTATCAAAGTTATTTTGAGATATGATGACTCTTATTACACTTGGAGTGGTGCA
TTTATGTTCGGTTCTATTCTCTCATGTACAGATACAGTAGCCGTCCTAGCTCTTTTAAAA
GAAGTAGGCGCTCCTAAAAAATTTAATTCGCTGATTGAAGGAGAATCATTACTTAACGAT
GGTACCTGTATGGTTCTTTTCCAAATATCAAGTGAATTCGCAAAAAAAGTTGATTAGAAT
ACATAAAATCAGGTATTAAATTAAATCTTTTATATATAAACATTAGCTAAGATAGACAGA
TAATTATAGTTTATAGCTTAATTTTTATATTATTTTAAAATAAAACCTTAGCTTATATAT
TTTATTACTCAAAAAAAAAAGTAATTAGAGTACCCAAATAGTAATTTTAGTCTACATTTA
AAAAGCTATTAATTTTAAATAAATAAAATATGATGAGAATATTTAATATTTATATGAATT
AAATTAGTAATATTTTGATTTGTTTGAAGTGATCAAACTTTTGCTTTCTCTCACTGTTGG
TGGTACACTTCTCGGTATTGTTTTTGGCATGATAGCCTAGTTTTGGATGCGTAGAATACA
TAATGATCCGATATTGACAGTCAATATAACCTTCATTGTTTGCTATCTAACTTACTATGT
AGCAGAAAATGTAGATATTGGAATAAAAGTCTCAGGAATTATGGCTCTAGTTTCTCTTGG
TATTTATCTCTCTATATTTGGTAAAACTAAAATTTCAAGTGAAGAAAAGAGAACTGTTTA
TATTTTCTGGAAGTACGTAACTTATGCTGGTGAATCAATTATTTTTATATTAGCTGGTGT
ATTAGTTGGTGTTAAAGTTTTAACATCTAATGGGGATTACGACACTATGTCAGGAAGCGA
TAATGTTTCTTCTTCAATTTAAACTAGTGATTATTTTAAACTTTTTGGTCTTTACGTTTG
TATGATCTTGAGTCGCTTTGGTAGTATTGCTTGCTTTATGTCTTGGTTGAGAAAATGGGG
TTATGGTCTTACTTGGAAGGAAGTTTATGTCCTTGCTTACGGTGGTCTTAGAGGAGCTAT
TGGTAATTTTATAAGTAAGTTAAATAAAAATAATATTTTAAATTTTATTTAGGTATTTCT
TTTGCAATGATTGTTGCTAATGATGACTCTTACTCTCAAAAATTAAGAGATATTATTTTA
TTCGATATGGCTGGAAATGCAATTTTAACATTAATTATCAATGGAACAACTACTGGTAAT
TTGTTTAATTTTAAATAAAGTATTTATTACAAATTTTATGATATTTTTAGGTCCTTTGAT
TAAGAGTTTAGGATTATGCGTTACAAGCACAGTTAGAGAAAGAGTCTTTTTAAATATTTT
ACAAGATTTGAAGGAAGATACTGAAAAAAAGATTAATTATTTGAAATCTAATAACTATCT
AAAGATGGTCAATTGGGATAGTGTTAAAGAATATGTAGGATTAGCAGATTTGGAGCAAAG
AATTACAAGATTAGAGTCAGATCTAACTAAAAGAGAAGAAATTGAAGAGTATACAAGAAA
TATAAGAAATAAAAATGTAATTGATGCTAAGATAGATGAACTTAAAAACTCTAATGAATT
TTAAGAGTAGTAATCATTTGACTCAGATTCAACAAATCACAATCTTGATGAAAATATGAT
AGTTGAATGTAGAAATAGATTTTTGATGGCTCTCAAAGGAAATTATTGGTACAAAAATTT
CAAAAAAATTTATTTTTTTTATTTCTAACTTTAAATAATTTTGAATAAAGGGATATTTAT
GAAAGAAATCAGTGCAGCAGTAATGCTTTATTATTGTTGATTGATTCAGTAAATTGGGAT
CTGGATACTGAATAAGAAAGAATGAACTCATGGGAATTTCTTTCCAATTACTTTTACAAT
CCTATTTACATCAAAGTGCTCTTTTAATTAAAAGGATGGCCTATTGTTGGATCTTATGCT
GGTAACCTCCTCTTTAACCATATCTCTAATATTTATGATGTCATTGCTGCTTATATTGAA
GCTCATGAACAAGCTGAGCAACTTTGCATAGATCAATTCCCTTTCATTCCCTAAGTAAAT
AAATACATTTACAAGAGCATAAAAAAGAATTGTATTTTTTACAAATTAATATTAAAAATA
GGTTTTAGAAATTATTATCAGAGAAAGCTAAGATAATAGAATGAGTGGCGAAGAGTATAT
CAAAAATGATTTAAATGTAAGTTTCCCAGAAATTACTAAACAAATCCAAACTAAGAAGGC
AACCTACAGTTTATTAGAGTGCTAAAAGAAAATAATAAAGAAGGGTATTTTGTTAGGTAA
GATAGATGAAAAAGAAAGAGATATATTAATGTAATAAATCGATGATAGAGTAGTTGCTTT
AGACAACATCAAACCTTCTTGGAAAGCTCCTCCAATCAAAAATTTCTTAGAAAATGTAAT
ATTTTTATTTATAGTAAAATTTTTTAAAACAAAATAAAAAATAAAGGTTCCATTCTTTAA
ACTCATCCACAAAGATTTACTTCCATACATCATCAAAGAATCTGTTGAGATGATTTTTGA
AAAAGATATGTACATCATCAAAGAAGGTGAGAAAGCTAAATACTTTTTTGTTATCACTAG
AGGTAGTGCTACAGAAACAACATCTTAGAGCTTTTGCACGTAAATTTATAATTATTTATT
CAGTAAATGTTATGTCTTTTTAGATATCAAGAATAAAAGGAAGTTGGCAGTTTAATTTCT
CCTCACCACTTGATTGTACCAAGTTTGAGATACTTGACTTCCTGCATGGCTAATGCAGTT
GTATACGTTCTTGCTTTCCCTTTAAGCTCAATTTAGAAAGTTATCAAAGTTAATTTAGAA
ATAAAGGAATATGTTTGGATGTAGAGTCTGAGAGCATTGAGTTAGCTTTTCTATAATGAA
CTTAAACCTTTAGGAAGTTTAGATAGAAACAGTTTTATTAAACTTCAACCAAAGTTGAAA
TTTGCTAAATATAAGTAAACATTTTTAATAAATTAAATTTTTCTAGTTATGCTTAATTGA
TGGCTTAAAAAAATAGCAAAGGGAAGACTATCTAGTGTGAAAGTGGTGGTATTCTTTTGA
AAGGACAAGTTTCGAGAAAGGATTTAACAGATGTGATGATGACATAATCTAAAGTAAATA
ATGACGAGGTAAAAAAATCAGATTTGATTGATGGTAGAATTTATAAGGTAAATAAAATAT
TTATTAGTTATGAAAATATCATTTATTTTTAATCTTAAAAAAATAGGCATTTTGTGTTTT
AATGCCAGGATAAGCTTTTTCAGTTTTCACAGAAAAGAAGTGTACATTTTTGCACTTTGC
TGAAGACTGTGAAGAAATTAGGTTTATGATTAGTCATATGGACTACAATGTTGGCATTAA
TTAGTAAACACCTCATACTCTTAACATATTTAGTCCTGTAGCTGTTTCTGGATCTCATAA
TAAGAGAAACAGTTTTTAAGCTCCCCACTTAAGTAGATTTGCAGGTAGACATACTTTTAA
TAATTTAGAAGTAGTTGTGCAAGGTAGTGAAAATAAAATAAATTCAGGATAATAAATAGA
ATTGCAAAAGATGAAATCTAAATCATACTTAAACGACTAACAAATAAAGAGTGTAAAGAG
TGATGATGAAGAATCAGATGATAATAAAGAAAAGTGA