Identifiers and Description

Gene Model Identifier

TTHERM_00471730

Standard Name

NCB2 (nuclear cap-binding protein subunit 2)

Aliases

PreTt22581 | 56.m00285 | 3686.m00128

Description

nuclear cap binding protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00076 ) RNA recognition motif. (a.k.a. RRM,

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.9%

TetraMine Data

TTHERM_00471730

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_11273.13.999369102302453e-125nuclear cap binding protein (2
34 aa)
DictyBaseDDB_G02871973.00039543526891e-44ncbp2 on chromosome: 4 positio
n 5395993 to 5396806
OxytrichaContig9742.0.g622.0005131442217614e-40RNA recognition motif_ (a_k_a_
RRM, RBD, or RNP domain)
WormBaseWBGene000091411.9998323414791308e-36locus:ncbp-2 Nuclear cap-bin
ding protein subunit 2 statu
s:Confirmed UniProt:Q93594
protein_id:CCD31067.1
SGDYPL178W1.000137892321693e-31CBC2 Small subunit of the hete
rodimeric cap binding complex
that also contains Sto1p, comp
onent of the spliceosomal comm
itment complex; interacts with
Npl3p, possibly to package mR
NA for export from the nucleus
; contains an RNA-binding moti
f
Stentor CoeruleusSteCoe_188400.000000000000012664165549094176

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:26688337: Kataoka K, Mochizuki K (2015) Phosphorylation of an HP1-like Protein Regulates Heterochromatin Body Assembly for DNA Elimination. Developmental cell 35(6):775-88

Sequences

>TTHERM_00471730(coding)
ATGGCATCCTTTTTGTATGATAGTCTTTAACCTTAGAGTTTGTATTATGATAAAAAATCA
GAACTTAGCGAATAGGATTATAAAAAAAGACTTGAAACTACTACAACTGTATATGTAGGA
AATTTACATTTCCAAACAAGAGAGAGCGCACTTTATGAATTATTCTCTCGTGCAGGATAA
ATTAAAGATCTTATAATGGGTATTAATAAAGAAGGTTAATCAGCAGGATTCTGTTTTGTT
GTTTACCACACTCACGAAGAAGCTAGAATAGCAGTTGAATATATTTCATAGACAAAACTA
AATGATAGAGTGATTAGAGTAGATTGGGATTATGGTTTTAAAGAAGGAAGATAGTTTGGA
AGAGGTATGGATGGATATCAAAAAAGAGATTAATACAGATAATAAAATGACTCTGGACGT
CATAATATTCATTAGTAATGGAAGGAGCGTTAACAATAGCAATTTTAAGAAAGGTCTAAT
AGTAGAGGTGGCTTTAGAGGGGGCAACAACTATAATTAAGGATAAAGAGAAGGTTATAAG
GGAAGGTTTAATAATAATTAGGGCAATCATAACTTTGATGAAAATAGTTAAAATAGATAT
AAAAAGAGCTACAACTAATTTAGAAATGAACAAAAAGAAAGAAGTAATTCAAGTTCTCCA
GAATATCCTAAGAAAAAGAGATAATAGTAAGATGATGAAAATGATGATTGA


>TTHERM_00471730(protein)
MASFLYDSLQPQSLYYDKKSELSEQDYKKRLETTTTVYVGNLHFQTRESALYELFSRAGQ
IKDLIMGINKEGQSAGFCFVVYHTHEEARIAVEYISQTKLNDRVIRVDWDYGFKEGRQFG
RGMDGYQKRDQYRQQNDSGRHNIHQQWKERQQQQFQERSNSRGGFRGGNNYNQGQREGYK
GRFNNNQGNHNFDENSQNRYKKSYNQFRNEQKERSNSSSPEYPKKKRQQQDDENDD


>TTHERM_00471730(gene)
ATGGCATCCTTTTTGTATGATAGTCTTTAACCTTAGAGTTTGTATTATGATAAAAAATCA
GAACTTAGCGAATAGGATTATAAAAAAAGACTTGAAACTACTACAACTGTATATGTAGGA
AATTTACATTTCCAAACAAGAGAGAGCGCACTTTATGAATTATTCTCTCGTGCAGGATAA
ATTAAAGATCTTATAATGGGTATTAATAAAGAAGGTTAATCAGCAGGATTCTGTTTTGTT
GTGTAATTTAAGTTATTTTTTGAAAAATTTATAATTTTGTTTAAATAAATGTGTAAAAAT
ATATAATAGCTATAAATATATAAATTTCGTTATTTAAAAAAAGTTACCACACTCACGAAG
AAGCTAGAATAGCAGTTGAATATATTTCATAGACAAAGTTGGTTATTAAATTTTATCATT
TAAAAAAATCTAACTAGTTACTAAGAAAAATTTTAATTTATTAAAACTTAGACTAAATGA
TAGAGTGATTAGAGTAGATTGGGATTATGGTTTTAAAGAAGGAAGATAGTTTGGAAGAGG
TATGGATGGATATCAAAAAAGAGATTAATACAGATAATAAAATGACTCTGGACGTCATAA
TATTCATTAGTAATGGAAGGAGCGTTAACAATAGCAATTTTAAGAAAGGTCTAATAGTAG
AGGTGGCTTTAGAGGGGGCAACAACTATAATTAAGGATAAAGAGAAGGTTATAAGGGAAG
GTTTAATAATAATTAGGGCAATCATAACTTTGATGAAAATAGTTAAAATAGATATAAAAA
GAGCTACAACTAATTTAGAAATGAACAAGTATATTTATAAATATTTTAATTGTAAATTAA
TTAATATCATTTTATCATAATACAATAGAAAGAAAGAAGTAATTCAAGTTCTCCAGAATA
TCCTAAGAAAAAGAGATAATAGTAAGATGATGAAAATGATGATTGA