Identifiers and Description

Gene Model Identifier

TTHERM_00404240

Standard Name

NCB1 (nuclear cap-binding protein subunit 1)

Aliases

PreTt12770 | 43.m00288 | 3713.m00112

Description

NCB1 MIF4G domain protein; nuclear cap-binding protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00404240

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13958.19.997093137033517e-262MIF4G domain-containing protei
n (887 aa)
DictyBaseDDB_G02698140.0000000010002658722841845ncbp1 on chromosome: 1 positio
n 3661674 to 3664325

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00404240(coding)
ATGAAGACTAAGGAGTAATTCGAAGATTAAATAAGAAAGAATAAAGCAAAGCTATCTGAA
AACGACAGAATTAAGATTTTAGTTGTTAGAGTTTGTGAAGATAGCCCTAAAACATTTGTG
TTGTCAATAAGAAAGTTGGCTGATTAAATTATTGAATATGCCCAAAAACCCGAAAAAGTA
GAATACAAAGATGTACTAATCAGATATTTCGTTGATTCAGTATCCCTTTTGTCATTTAAG
CAAGCAGTTTATGCAACCGTACTTTCTTTAGTTTTCTTAAAGTCTAAGAGTATTTTTGAT
GAACTACTTAAAAGAATCACTGACTAGTTCCAAAAGAGTCTTGATAATGGTGAAAGAATT
AAGTCTAAGAACATTTTGATATTTTTGGGAGAACTCATGAACATTGGTGTTGTTAATGGA
TTTAATTACAGATAATTAGTTGTTTAAATACTAGATCAATGTAAGTAGCTAGAAAATTAA
GAAGAAAGAGAATATTATCTTTCTATTGTTGTAGGAAGTTTGGGATATGTTTAAGAGTAC
TTGATGAAAAAAATGGGCCATGAATATGAACAAATTATTAAAGAAATACAAAACTTAATG
AAGAAAAGAGATACTTCTTATATCTAGATATTCAAGAATAAATATAATAAAGACAAAGAT
TATGATAGATTGTAAATGTTGTGGCTAAGCATCTTGCGTGATTTAGAAAAGTCTAAAAAG
CATTCTTCTAGCTCTAATGAGACAGTCGATGTCAATTAAGATCAACATCCTTCTTTAAAG
AGACCATATTTACAGTTTTCAAATGACTTAAAGAATATTGAATAGCCAGAATTTTCTTTT
ATTGTAGAATTTAAGAACAGAAACAGCTCTAAGTGTGTTTATTAATCTCCTTTATTCAGC
AGCACAATCTTAAAATATGATGAGGAAATAGAGCGTCTGAGAGAAGAAGAAGAGCAATAA
AGAGCTGATGAAGAAGGCGAAGAGGAAGAAGAAATTGAAGAAGAATTAGATGAAGAAGAA
GACTATGATGATGAAGAGGAAGATGGAGGAAGAGGTTCTAAACCAAAAAAATCTAAAAAA
TCTAATCAAAGTACTATTAAAAAAAGCAGTAAAAAGAAAAGCCCAAGAAAATTATATGGA
ATCACAACAGAAAGACTAATTTTCCATGAAAACAGTTTATAAACTATTTAACTTTTTAGA
CAATCTAAAAAAAATTTATTTGAGTAAATTAAAATGCTTGTAAGAATGTGTGGAGAAGAA
ACTTAAACTTAGAAATAAGAAGCTGAATTTATTTTTAATTCATTTGTCGATTTGTTATTT
GTCGAAAGTGTGAGAAGCAAAAATGGCACTCTTGAAGATCAAATAGCTTCTAGAGTTTTA
TATTTCAGTTCATTGGCAAATACATTGCATTCTTTGAAGAAAGATGAAAGTGCAGATATT
ATTTATGATGCTTTTAATGAAGTTTACCGCCATTTAAATGAATATACAGCTGATTCTGTG
GAGAGTTTGGCTGAGTTCATAAGCCATGTTTTAAGTGAAACTCATTTATCATTCCCATGG
GAAAGAATTACTTTGGCTGTTTCTAAGTAAGAAATTGCTTCATCAGTCAATCCTTAAGTT
CTCTTATGGAGAGATATAATTTACAAATTGTGTTTACTTTGTGGCAGAGAAAAAGTTGAA
AATGCTTTGAAGGGAAGCAACGGCTAAGACGAAACTCCTGCTAACATTTTACTATAATTC
CTTACCCCTATCTAAGTTAAAGAGATTATCAAAACTAAATATTAGCAAGATCCTTTAGCT
CAAAGATTCATGGAACTTTTAGTTCAAAAGAAAACTCATGAAGAAATGGGCGAAGAAATC
AACGAGGCTTTGAAAGAAGGAATTGACGATGAAGGTGAAGATGAAAATGAAAAGAAAAAT
TTTGTTATCAGTGTTTTCTTGGAATGCTTATTTTTCAGATCTTGTGAGACTTTCACTCAC
TTAAAAATCTTGTATGACAGATATGCTCCTTTGTTGAAAAAGTTATTAGAAGAACACGGA
GAAGTCTTTTAAAACGCTCTTGTAAACACTCTCCTATTATTCTGGTAGAATAACTCATCA
AATCTTGAACATTATTTGAAGAAATTTATCTCTAACAATTTTATTACACCATAAATTGTT
GCTTCTTCCATCTTCGAACACTTAAAAGAGCTGAAAGCTTCCTCTGCATCTGTAAGATAA
GTTCATCAACTCTGGCTCTTCTTGAGAAGAATCACTTTTAATATTTTTGATACATTCCAC
AACTACACAGAAGAAGTTAATTCAAATATATATCAAGGACAAGACGAAGAAGAAAAAGCA
GGAGAAGTTGAAACACTCTCTTAAAAATTAGAAAAGGCTAAACAACAATTAACCGAACTG
CTTGAAATTATATTCAGCCAATTTGAATCTATATTTAGCGAAGTCACAGCAGATGAGATA
AAAGATAAGCAATACGACACCTATTTCTTGTACTTTTACAGAAAGTATAAAAAATTTGTA
GATTGGGAAAATACTTATCAAAGTTAATTTAGCTCATTTAAAAATATTCCATAGAATGTT
ATTCAAAGCTATAGAATCTGA


>TTHERM_00404240(protein)
MKTKEQFEDQIRKNKAKLSENDRIKILVVRVCEDSPKTFVLSIRKLADQIIEYAQKPEKV
EYKDVLIRYFVDSVSLLSFKQAVYATVLSLVFLKSKSIFDELLKRITDQFQKSLDNGERI
KSKNILIFLGELMNIGVVNGFNYRQLVVQILDQCKQLENQEEREYYLSIVVGSLGYVQEY
LMKKMGHEYEQIIKEIQNLMKKRDTSYIQIFKNKYNKDKDYDRLQMLWLSILRDLEKSKK
HSSSSNETVDVNQDQHPSLKRPYLQFSNDLKNIEQPEFSFIVEFKNRNSSKCVYQSPLFS
STILKYDEEIERLREEEEQQRADEEGEEEEEIEEELDEEEDYDDEEEDGGRGSKPKKSKK
SNQSTIKKSSKKKSPRKLYGITTERLIFHENSLQTIQLFRQSKKNLFEQIKMLVRMCGEE
TQTQKQEAEFIFNSFVDLLFVESVRSKNGTLEDQIASRVLYFSSLANTLHSLKKDESADI
IYDAFNEVYRHLNEYTADSVESLAEFISHVLSETHLSFPWERITLAVSKQEIASSVNPQV
LLWRDIIYKLCLLCGREKVENALKGSNGQDETPANILLQFLTPIQVKEIIKTKYQQDPLA
QRFMELLVQKKTHEEMGEEINEALKEGIDDEGEDENEKKNFVISVFLECLFFRSCETFTH
LKILYDRYAPLLKKLLEEHGEVFQNALVNTLLLFWQNNSSNLEHYLKKFISNNFITPQIV
ASSIFEHLKELKASSASVRQVHQLWLFLRRITFNIFDTFHNYTEEVNSNIYQGQDEEEKA
GEVETLSQKLEKAKQQLTELLEIIFSQFESIFSEVTADEIKDKQYDTYFLYFYRKYKKFV
DWENTYQSQFSSFKNIPQNVIQSYRI


>TTHERM_00404240(gene)
ATGAAGACTAAGGGTAAATAAATTTTTCTTACACATTTTCGAAAACATTCTATGTAAAAA
AAGAATGTTTTGCGCTTCATTCATATTTGAATGAAAAAAGTGTCTAAACCTTCTATTTCT
TTCTTTTTTCTCAATTTAAAAATCTTAATCAAATTTTATGAATTTAAAGCAAAAAAATTA
ATTTTTCACAAAAAATTAAAAGGCCTTTCTTTTTAATAAAATCACAGGTAGATCTGATAA
ATTCTGACAAATTAAAATAAAAAAAGCAAGAAGGCTACTTAGCTTTCAAATTTTAAATAA
AATCTTATTGAAATTCCGCTGACATTAAGTATCCAGTCAGCGGAATTTCAATACCTGGAT
TAGCAATAAATAATAAAAAATACTTTTGATTAAACAGTGTATTAGAATATTTTTATTTTG
ATTTACTTTCAAAAGAAAACAAATATATTTATTCTCTTTAAATTAAACAAAATTTTCATG
CAAAATTTAAAAATTTTCTTAATTAATTTATTTAATCATTCCTTTTTTAAAATAAAAAGA
AAATAATTGAAAGGAATTTCTAATTGAAAATAATTGTTTTCATTTAGTATATATCAACGT
ATCAAGTATCACAAACACAAAATATTAATTTTTCATTATTTTACACAATTATTTTTACTT
TTTTGTATTAAAATTTAAGATTAACTTAATTAAAGTGAGAAGAAATAGTGAAAATATTTT
TTTTTAAATAAAACATGTTCTATGCAAATAGAAATTTATTTAATTTATCAAAGTTAACAA
TTTGTTTTCAATTTTCAATAAAATTTTCGATTTAAAATAACAATAATTTATTATTTATTT
GTTTGTTTACTTTAATAAGATAAAAAAATATTATTAAAAATAATTATTAAATAAAACATT
AATTTTTATAGAAAAACATAAGCACAAATAAATATTGATTTAATTATTTTTGGGTTGCTG
GTTTTGTGCATAAATTATAATTACAAAGTGAAAAGTAGTTAAAAGAAAAGATATGTATTT
GGTGTTTATATTCAGATTTGCATCTAGCTGCATCAAAAAAAGAATGATTAATGTAGTGTC
CTATATATTTCCATATGGTTGCAATTATTTAATTTTTTAAATTTTGCGGTAGATCAAAAC
AAAATCTAAATTTTTTGTTTTTATAGATAAGAGTTAATAAGATTTAATATAAAAGTTTAT
TAGCAATAAAGGTAAATAAAGATATATTTATTATTTGAAAAGGATAAACTCAATTAAATC
CAATTTTTACATATTTAAAATCTTCAGAATACCTAACTCAACCAGCAAGCAAGCAAGCAA
CTAAGCAAACACTCAATAAATAAATATTTAAATTAATAATAGAAAAAGAATTGATCATAT
CTCATGAGCTAGCAAGTCACTTAATCGGAATCTAAATAGGAAACATAGCAAAGCAAATTC
AGCAAGATCGAAACTACATCAGAGTAATTCGAAGATTAAATAAGAAAGAATAAAGCAAAG
CTATCTGAAAACGACAGAATTAAGATTTTAGTTGTTAGAGTTTGTGAAGATAGCCCTAAA
ACATTTGTGTTGTCAATAAGAAAGTTGGCTGATTAAATTATTGAATATGCCCAAAAACCC
GAAAAAGTAGAATACAAAGATGTACTAATCAGATATTTCGTTGATTCAGTATCCCTTTTG
TCATTTAAGCAAGCAGTTTATGCAACCGTACTTTCTTTAGTTTTCTTAAAGTCTAAGAGT
ATTTTTGATGAACTACTTAAAAGAATCACTGACTAGTTCCAAAAGAGTCTTGATAATGGT
AAAGAAGCAATTTCATATTATAATTATTGACTCATTTTTATTGTCATCTATTTCATTAAA
TTTCCTATTAAATGATCTAGATTGAAACAAATAAAATTGAAATTCAACAATAAAAATAAA
ATACAAAGAAACTAAGACTTTTTTTAACACCAACAATAAATTTAAAAATCATTTCAATCA
AACTCATCTTTGTTTGATACTAAAGTTCTTTTAAAAAAAAAGATTTTTTCTTATGACAAT
TTATATTTTCAATTATTATGAATAGATAAATTTAAAATAATTCAATTGATAAATAAAAAT
AGGTGAAAGAATTAAGTCTAAGAACATTTTGATATTTTTGGGAGAACTCATGAACATTGG
TGTTGTTAATGGATTTAATTACAGATAATTAGTTGTTTAAATACTAGATCAATGTAAGTA
GCTAGAAAATTAAGAAGAAAGAGAATATTATCTTTCTATTGTTGTAGGAAGTTTGGGATA
TGTTTAAGAGTACTTGATGAAAAAAATGGGCCATGAATATGAACAAATTATTAAAGAAAT
ACAAAACTTAATGAAGAAAAGAGATACTTCTTATATCTAGATATTCAAGAATAAATATAA
TAAAGACAAAGATTATGATAGATTGTAAATGTTGTGGCTAAGCATCTTGCGTGATTTAGA
AAAGTCTAAAAAGCATTCTTCTAGCTCTAATGAGACAGTCGATGTCAATTAAGATCAACA
TCCTTCTTTAAAGAGACCATATTTACAGTTTTCAAATGACTTAAAGAATATTGAATAGCC
AGAATTTTCTTTTATTGTAGAATTTAAGAACAGAAACAGCTCTAAGTGTGTTTATTAATC
TCCTTTATTCAGCAGCACAATCTTAAAATATGATGAGGAAATAGAGCGTCTGAGAGAAGA
AGAAGAGCAATAAAGAGCTGATGAAGAAGGCGAAGAGGAAGAAGAAATTGAAGAAGAATT
AGATGAAGAAGAAGACTATGATGATGAAGAGGAAGATGGAGGAAGAGGTTCTAAACCAAA
AAAATCTAAAAAATCTAATCAAAGTACTATTAAAAAAAGCAGTAAAAAGAAAAGCCCAAG
AAAATTATATGGAATCACAACAGAAAGACTAATTTTCCATGAAAACAGTTTATAAACTAT
TTAACTTTTTAGACAATCTAAAAAAAATTTATTTGAGTAAATTAAAATGCTTGTAAGAAT
GTGTGGAGAAGAAACTTAAACTTAGAAATAAGAAGCTGAATTTATTTTTAATTCATTTGT
CGATTTGTTATTTGTCGAAAGTGTGAGAAGCAAAAATGGCACTCTTGAAGATCAAATAGC
TTCTAGAGTTTTATATTTCAGGTAAATAATTTTGATTTATGATTTATTTGAAAGAAGTAA
TGTAATTGTCTTTTTATCTTTCAGAATTAGAAAGTGTGTTTGAGCAAAATACAAATTAAA
GCTTTTTTTTATTATAAGAAAATATTTCTCCAAAATAAAATGGATGCAATTACTTTCTTT
CTTTCTTTTTTATTTGTTTATTAGAAAAAAATAATTTAGATTAATTTAATTTTCATTTAC
ATACAATTAGTTCATTGGCAAATACATTGCATTCTTTGAAGAAAGATGAAAGTGCAGATA
TTATTTATGATGCTTTTAATGAAGTTTACCGCCATTTAAATGAATATACAGCTGATTCTG
TGGAGAGTTTGGCTGAGTTCATAAGCCATGTTTTAAGTGAAACTCATTTATCATTCCCAT
GGGAAAGAATTACTTTGGCTGTTTCTAAGTAAGAAATTGCTTCATCAGTCAATCCTTAAG
TTCTCTTATGGAGAGATATAATTTACAAATTGTGTTTACTTTGTGGCAGAGAAAAAGTTG
AAAATGCTTTGAAGGGAAGCAACGGCTAAGACGAAACTCCTGCTAACATTTTACTATAAT
TCCTTACCCCTATCTAAGTTAAAGAGATTATCAAAACTAAATATTAGCAAGATCCTTTAG
CTCAAAGATTCATGGAACTTTTAGTTCAAAAGAAAACTCATGAAGAAATGGGCGAAGAAA
TCAACGAGGCTTTGAAAGAAGGAATTGACGATGAAGGTGAAGATGAAAATGAAAAGAAAA
ATTTTGTTATCAGTGTTTTCTTGGAATGCTTATTTTTCAGATCTTGTGAGACTTTCACTC
ACTTAAAAATCTTGTATGACAGATATGCTCCTTTGTTGAAAAAGTTATTAGAAGAACACG
GAGAAGTCTTTTAAAACGCTCTTGTAAACACTCTCCTATTATTCTGGTAGAATAACTCAT
CAAATCTTGAACATTATTTGAAGAAATTTATCTCTAACAATTTTATTACACCATAAATTG
TTGCTTCTTCCATCTTCGAACACTTAAAAGAGCTGAAAGCTTCCTCTGCATCTGTAAGAT
AAGTTCATCAACTCTGGCTCTTCTTGAGAAGAATCACTTTTAATATTTTTGATACATTCC
ACAACTACACAGAAGAAGTTAATTCAAATATATATCAAGGACAAGACGAAGAAGAAAAAG
CAGGAGAAGTTGAAACACTCTCTTAAAAATTAGAAAAGGCTAAACAACAATTAACCGAAC
TGCTTGAAATTATATTCAGCCAATTTGAATCTATATTTAGCGAAGTCACAGCAGATGAGA
TAAAAGATAAGCAATACGACACCTATTTCTTGTACTTTTACAGAAAGTATAAAAAATTTG
TAGATTGGGAAAATACTTATCAAAGTTAATTTAGCTCATTTAAAAATATTCCATAGAATG
TTATTCAAAGCTATAGAATCTGA