Identifiers and Description

Gene Model Identifier

TTHERM_00218670

Standard Name

NAT1 (N-terminal AcetylTransferase )

Aliases

PreTt22294 | 18.m00320 | 3701.m00080

Description

N-terminally acetylates many proteins, which influences multiple processes such as the cell cycle, heat-shock resistance, mating, sporulation, and telomeric silencing

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF08253 ) Erm Leader peptide
  • ( PF00515 ) tetratricopeptide repeat
  • ( PF07719 ) tetratricopeptide repeat
  • ( TIGR02521 ) type IV pilus biogenesis/stability protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.6%

TetraMine Data

TTHERM_00218670

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_06642.19.997093137033517e-262TPR Domain containing protein
(855 aa)
OxytrichaContig21269.0.g502.0000857274312427e-108NMDA receptor-regulated protei
n 1
WormBaseWBGene000217546.998907184881904e-97locus:hpo-29 status:Partiall
y_confirmed UniProt:Q8WTL6
protein_id:CCD73791.1
DictyBaseDDB_G02750752.0008734984431652e-95DDB_G0275075 on chromosome: 2
position 5130987 to 5134105
SGDYDL040C9.999353957415832e-59NAT1 Subunit of the N-terminal
acetyltransferase NatA (Nat1p
, Ard1p, Nat5p); N-terminally
acetylates many proteins, whic
h influences multiple processe
s such as the cell cycle, heat
-shock resistance, mating, spo
rulation, and telomeric silenc
ing
Stentor CoeruleusSteCoe_210757.47197233734299e-43

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00218670(coding)
ATGTTAAAAGGTGCAATTGATTCACTCGATAGTAAATAAGCAGCTCTTTTCAAAAACTTA
GTTAAATTCTATGAAACTAAGTAGTACAAAAAAGGTCTTAAGTAAGCTGACAAGCTATTA
GAATAAAAGCCTAACCATGCAGAATCCATGGCTATGAAGGCTATATTCCTCTATTTCACT
GGATAAAAGAGTGAAGGATTGGATCTATCAAAGAAGGCTTTGATGAAAAATTTAAAAAGT
GACATAGCTTGGCATATTCACGGCATTATTAATAGAACAAACAGAAATTATTAGGAAGCC
ATCAACTGTTACAAGAAAGCTCTTGATATTTCTCCAGACAATGTGCAAATTTTAAGAGAT
TTAGCTTTACTTTAAGTTCAAATTCGTGATGTAGAAGGACTTTGTGATACTCGTAAAAAG
CTCCTCTTAAACAAGGAATCTTTGATTATTAATTGGGTTGCATACGCTTTTTCTCTTCAC
TTGAAAGGTTCAATTGAAGAATGTTTAAAAGTTATAGATTCTATCATCAACATCACTAAA
AATAATCCTCTCAAGGGTATTGAAAAAACAGAATTTTGCTTATATCACGCTTAAGTTTAT
GCTGATGGAGGCAACTATGAAATGTAATTAAAGATACTAGAATAAAACGAAGAAGGTATT
TTAGATAAGGTTGCACTCAACGAATAAAGAATTAAGGCTTACTTAAAATTGAATAAATAG
GACTAAGCAATTTAATGCATTGAAAAACTCATTGAGATCAATCCTTAAAATAGAAACTAC
TTCAATCTCCTTAAGTAAGCTAGAGGATTGCCTGAAATTCCTGCTAATGAAGAAGAGAGA
CTTAAAATTGTCAGCTTCTTTGAAGAAATAGGCGCTAAATACAATAGCAACATTATTTCA
TATATGGCTTTAGATTTCTCAAAAGGCCAAGATTTTGAAAATAAACTTATTAAGTATATT
ACTCCCTATTTCCGCAAGGGTATTCCCTCTCTTTTCTCTGAATTGAAACACCTTTACTAA
GATAATGAAAAGGTTTAAATCATTGAAAAAGTTCTTCTCAACAATTTAGCTTCTTTACAA
AAAGAATCAAAATTCCCTAACTCTGATGCTATTGAAAGCCCTTGTTGCCTTTTATGGAAT
TACATGCTCTTAGCTTAACACTTTGACCGTGTTAACTAATTAACTAAAGCTCTTGAGTAC
GTAAACCTTGCAATCAATCATACACCCACATTGATTGAACTCTATTTAGTTAAAGCTAAA
ATCTACAAGCACTAATTCAATCACAAGGTAGCATTTGAGAATGCTGATAAGGCAAGAACT
ATGGATTTAGCTGATAGATATTTGAATAACAAAGCAATCAAGTATGCTTTAAGATGTGGA
TTTTTTGATTAGGCTAACGACTTGCTCAGATTATTCCTTAAAGACCCTTCTGAAGGTAAT
CCCTTCGAGTTATAAACCTTATGGTATGAAATTGCTTAAGGTGAAACCCTTCTTAAAAAG
GGTGAATATGCTAGAGCTTTGAGAATGTTTAAGTTCGTCCAAAAGGCTTTTATTGATATT
TATGAGGATTAATTCGATTTCCACACTTATTGTATTCGTAAATATAATTTAAACACATAT
ACCAATCTTCTTAACTATGAGAATGGTGTTTACAACTAGAAGCCTTTCATTTATGGAAGT
ACTTTGTTAGTCCAATCCTTGATGGAATACATCACTGTCAGACTCGTAGAAATTAAAAAG
AAAGAGGAAGAAGAACTTAGAATTAAAAATATGACATAAATGGAAAAGAAGAAGTGGAAA
AAGTAATAGGAAATTGAAGCTGAAAAAGCTGCTAAAGATCCTAATGTTGAATTTAGAAAA
AAGCATGACTTAGATGGAGAAGAATTCAGAAATTCTCAACCTTTAGTCGAAGCCAATCAT
GTTGCAAAGCAATTAATCCACACTAAAGTTTCAAATCCTCAATTAAAATTCAAGAGTTCT
TATGTCTTAGTTGATTTCTATATTGAAACAAACAGACCTCTTCTTTTAATTAAGGCTTTG
AACAAGGTTATTTCTTCTAATCACTGTGCTAATGGAATCCATTTAGCTAAATTGAAGGCA
GCTATTTACTTGGAAAAATTCTTAAAGGGTGATAAATTGAATGAACACGTCAAGAAGTAT
AGCGAAGAAGCTTTACACAATATTTTAAATGGCAAAACAATTGAACAATTTAACACTGAA
TATATTAGTAAAAATACTAGCTCTAATGGTTGCTACAAAAATGCTCTTCATGCTTTAAAG
TGTGATATCGTTTTAGGAAAGGCTAATAAAGAATAACTTTTGAAGTTCCATGAAGATTTA
CTCATGAATAGAAATGACTTAACACTTTAATAAGCAACCTAATTATTTGATGAATTTATC
AAGCTTAACGATTTCAATTACAAGAACGAAGTTTCTGAAAAATTATAGAAGTAGTTCCCT
GAAAGTGAATACTACTTTGGAAAGTATAGATTTGATGAAAAGACTCATCTTGAATTAGCT
CAACAATAATAACAATAAGATTCAAACAAAAAGTGA


>TTHERM_00218670(protein)
MLKGAIDSLDSKQAALFKNLVKFYETKQYKKGLKQADKLLEQKPNHAESMAMKAIFLYFT
GQKSEGLDLSKKALMKNLKSDIAWHIHGIINRTNRNYQEAINCYKKALDISPDNVQILRD
LALLQVQIRDVEGLCDTRKKLLLNKESLIINWVAYAFSLHLKGSIEECLKVIDSIINITK
NNPLKGIEKTEFCLYHAQVYADGGNYEMQLKILEQNEEGILDKVALNEQRIKAYLKLNKQ
DQAIQCIEKLIEINPQNRNYFNLLKQARGLPEIPANEEERLKIVSFFEEIGAKYNSNIIS
YMALDFSKGQDFENKLIKYITPYFRKGIPSLFSELKHLYQDNEKVQIIEKVLLNNLASLQ
KESKFPNSDAIESPCCLLWNYMLLAQHFDRVNQLTKALEYVNLAINHTPTLIELYLVKAK
IYKHQFNHKVAFENADKARTMDLADRYLNNKAIKYALRCGFFDQANDLLRLFLKDPSEGN
PFELQTLWYEIAQGETLLKKGEYARALRMFKFVQKAFIDIYEDQFDFHTYCIRKYNLNTY
TNLLNYENGVYNQKPFIYGSTLLVQSLMEYITVRLVEIKKKEEEELRIKNMTQMEKKKWK
KQQEIEAEKAAKDPNVEFRKKHDLDGEEFRNSQPLVEANHVAKQLIHTKVSNPQLKFKSS
YVLVDFYIETNRPLLLIKALNKVISSNHCANGIHLAKLKAAIYLEKFLKGDKLNEHVKKY
SEEALHNILNGKTIEQFNTEYISKNTSSNGCYKNALHALKCDIVLGKANKEQLLKFHEDL
LMNRNDLTLQQATQLFDEFIKLNDFNYKNEVSEKLQKQFPESEYYFGKYRFDEKTHLELA
QQQQQQDSNKK


>TTHERM_00218670(gene)
ATGTTAAAAGGTGCAATTGATTCACTCGATAGTAAATAAGCAGCTCTTTTCAAAAACTTA
GTTGTAATAAATATATATTATTTTGCAAGATGGATTACTTAAAAGGTTTTGGCTGTCTTC
TAAATATTTCTTTCAATATTTATTATTAACTAATGGGATTATACATATAGAAAATTAACA
AAATCCTATAAGATTATTTTAAAAAGTTAAAGAGAGCCAAATCTTGCAAATGTCTGAAAA
TATTTTATGACATCTACTTTAACAAAATTTTTAATTATATAGAAATTCTATGAAACTAAG
TAGTACAAAAAAGGTCTTAAGTAAGCTGACAAGCTATTAGAATAAAAGCCTAACCATGCA
GGTTTGCTAACACTTTTATTAATATTTTATGTTATTTACCAAAAAAATTTTTAAAAATCA
GAATCCATGGCTATGAAGGCTATATTCCTCTATTTCACTGGATAAAAGAGTGAAGGATTG
GATCTATCAAAGAAGGTTTTATTTATTTAAATATATAAAATAATTTATCTTTATAATTAA
TATGAATTTATATCTAACCTATTCAAAATGATATATACAGGCTTTGATGAAAAATTTAAA
AAGTGACATAGCTTGGCATATTCACGGCATTATTAATAGAACAAACAGAAATTATTAGGA
AGCCATCAACTGTTACAAGAAAGCTCTTGATATTTCTCCAGACAATGTGCAAATTTTAAG
AGATTTAGCTTTACTTTAAGTTCAAATTCGTGATGTAGAAGGACTTTGTGATACTCGTAA
AAAGCTCCTCTTAAACAAGGAATCTTTGATTATTAATTGGGTTGCATACGCTTTTTCTCT
TCACTTGGTATTATATTGTAAAAAAGAGATATAAATAATCATATTTTTATTGTAAATATA
GAAAGGTTCAATTGAAGAATGTTTAAAAGTTATAGATTCTATCATCAACATCACTAAAAA
TAATCCTCTCAAGGGTATTGAAAAAACAGAAGTATTGTGTTTTTTTATTAAAAAATGAGT
AAATTTATGTAACAAAAACTCACAATTAATATTAGTTTTGCTTATATCACGCTTAAGTTT
ATGCTGATGGAGGCAACTATGAAATGTAATTAAAGATACTAGAATAAAACGAAGAAGGTA
TTTTAGATAAGGTTGCACTCAACGAATAAAGAATTAAGGCTTACTTAAAATTGAATAAAT
AGGACTAAGCAATTTAATGCATTGAGTAATTCATATTTAGAATTTTCTTTATTTATTTAA
AAGATTTGCTGAAACAAAACAACAAAAAAAATGCAATTTTAATTTTAAACAGCATTTTGA
ATAAAAATTATTATCTAAAATTTTATTTTTAACATAGAAAACTCATTGAGATCAATCCTT
AAAATAGAAACTACTTCAATCTCCTTAAGTAAGCTAGAGGATTGCCTGAAATTCCTGCTA
ATGAAGAAGAGAGACTTAAAATTGTCAGCTTCTTTGAAGAAATAGGCGCTAAATACAATG
TAAATAAAATGATTAAATAATATTTTAAAGCTTAAATTACTATTAAAAATAGAGCAACAT
TATTTCATATATGGCTTTAGATTTCTCAAAAGGCCAAGATTTTGAAAATAAACTTATTAA
GTATATTACTCCCTATTTCCGCAAGGGTATTCCCTCTCTTTTCTCTGAATTGAAACACCT
TTACTAAGATAATGAAAAGGTTTAAATCATTGAAAAAGTTCTTCTCAACAATTTAGCTTC
TTTACAAAAAGAATCAAAATTCCCTAACTCTGATGCTATTGAAAGCCCTTGTTGCCTTTT
ATGGAATTACATGCTCTTAGCTTAACACTTTGACCGTGTTAACTAATTAACTAAAGCTCT
TGAGTACGTAAACCTTGCAATCAATCATACACCCACATTGATTGAACTCTATTTAGTTAA
AGCTAAAATCTACAAGCACTAATTCAATCACAAGGTAGCATTTGAGAATGCTGATAAGGT
AAAAAATAAAAAATTTAAAATGGCTATTGATCTTATATTATATTTATAAATAGGCAAGAA
CTATGGATTTAGCTGATAGATATTTGAATAACAAAGCAATCAAGTATGCTTTAAGATGTG
GATTTTTTGATTAGGCTAACGACTTGCTCAGATTATTCCTTAAAGACCCTTCTGAAGGTA
ATCCCTTCGAGTTATAAACCTTATGGTATGAAATTGCTTAAGGTGAAACCCTTCTTAAAA
AGGGTGAATATGCTAGAGCTTTGAGAATGTTTAAGTTCGTCCAAAAGGCTTTTATTGATA
TTTATGAGGATTAATTCGATTTCCACACTTATTGTATTCGTAAATATAATTTAAACACAT
ATACCAATCTTCTTAACTATGAGAATGGTGTTTACAACTAGAAGCCTTTCATTTATGGAA
GTACTTTGTTAGTCCAATCCTTGATGGAATACATCACTGTCAGACTCGTAGAAGTAAATT
GATTACTTAAATAAAATGAAAAATTTTCCCTAATTTTTACTTTGCATAAAATAGATTAAA
AAGAAAGAGGAAGAAGAACTTAGAATTAAAAATATGACATAAATGGAAAAGAAGAAGTGG
AAAAAGTAATAGGAAATTGAAGCTGAAAAAGCTGCTAAAGATCCTAATGTTGAATTTAGA
AAAAAGCATGACTTAGATGGAGAAGAATTCAGAAATTCTCAACCTTTAGTCGAAGCCAAT
CATGTTGCAAAGCAATTAATCCACACTAAAGTTTCAAATCCTCAATTAAAATTCAAGAGT
TCTTATGTCTTAGTTGATTTCTATATTGAAACAAACAGACCTCTTCTTTTAATTAAGGCT
TTGAACAAGGTTATTTCTTCTAATCACTGTGCTAATGGAATCCATTTAGCTAAATTGAAG
GCAGCTATTTACTGTAAATATTCAATATCTATCTATCTTTATTTTATAAGAATATTATTT
ATTTTTATTATTTAATAAATATAGTGGAAAAATTCTTAAAGGGTGATAAATTGAATGAAC
ACGTCAAGAAGTATAGCGAAGAAGCTTTACACAATATTTTAAATGGCAAAACAATTGAAC
AATTTAACACTGAATATATTAGTAAAAATACTAGCTCTAATGGTTGCTACAAAAATGCTC
TTCATGGTAACATTTTATTTAACGAATAATAGTTAAATATTAAATAATAAATTACTTTAT
TAAATAGCTTTAAAGTGTGATATCGTTTTAGGAAAGGCTAATAAAGAATAACTTTTGAAG
TTCCATGAAGATTTACTCATGAATAGAAATGACTTAACACTTTAATAAGCAACCTAATTA
TTTGATGAATTTATCAAGCTTAACGATTTCAATTACAAGAACGAAGTTTCTGTAATATAT
TTTGATTTCAAAAAATTATTTAATTTATTAAAACAATCCAATAATAAAAGGAAAAATTAT
AGAAGTAGTTCCCTGAAAGTGAATACTACTTTGGAAAGTATAGATTTGATGAAAAGACTC
ATCTTGAATTAGCTCAACAATAATAACAATAAGATTCAAACAAAAAGTGA