Identifiers and Description

Gene Model Identifier

TTHERM_00786930

Standard Name

NAP1 (Nucleosome Assembly Protein )

Aliases

PreTt08520 | 132.m00079 | 3755.m00440

Description

nucleosome assembly protein (NAP)"

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00786930

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_18786.17.00150717792659e-166nucleosome assembly protein (N
AP) (345 aa)
DictyBaseDDB_G02692905.999207186122604e-25nap1 on chromosome: 1 position
2468482 to 2469686
OxytrichaContig22315.0.g101.0002869940498747e-21Nucleosome assembly protein (N
AP)
SGDYKR048C9.99946582325553e-18NAP1 Protein that interacts wi
th mitotic cyclin Clb2p; requi
red for the regulation of micr
otubule dynamics during mitosi
s; controls bud morphogenesis;
involved in the transport of
H2A and H2B histones to the nu
cleus; phosphorylated by CK2
WormBaseWBGene000170752.9992476920535046e-16locus:nap-1 status:Confirmed
UniProt:Q19007 protein_id
:CCD68513.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00786930(coding)
ATGTCTTCTGAAACCGCCGCCAAGCACGACCACTAAAACTGTGAAGATCACGATCACGAT
CACGAAGAAATCGACATCGATTAATAAATCGAAGAATCCATCAAGGAATTAGCTCTTGGT
GAAAAGATCAGAGCTGTTGCTATCAACCACCACCTCGCTGAAAAGAAGGCCCTCGATGAA
GAACTCTAAAAGAAGATCCAAGCCCTCACCTTCGAATACGAACAAAAATCCATGCCCATC
TACGCTAAGACTCAAGAAATCGTTCAAGGTAGAGTTCCCACTGAAGAAGAATTGAAGGAC
TTAGAAAAGTACTTAAAGGAAGAAGAAAAGACTCAAGTTGAAGGTGCCAAGAAGGAAGAA
CCCATCACCGAATATTGGTTGAAGGCTATGAAGAGCAACGACGTTTTGGCTATGGAAATC
AAGGAACAAGACGAAACTGCCTTAAAGACCCTTACCAAGATCGAATACGTTTTGGAAGAT
ACCAAGAAGTTCCACATCGTCTTCACTTTCGGTCCCAACGACTACTTCACCAACACTGAA
TTAAAGAAGACCGTCGAATTAGATGAAAACGAAGAACCTGTTAAGACCACCGGTACTCCC
ATTGAATGGAAGGAAGGAAAGAACACCACCGTCAAGATCACCAAGAAGACCCAAAAGAAC
AAAAAGACTGGTGTCAAGAGAGTCGTTGAAAGAGAAACCAAGATCGAATCTTTCTTCAAT
TTCTTCTCTGACTCTGCTCCCACTGATGCCCCCGAAGAAGAAGACGAAGAAAAGGACGAA
CAAGCCATGGACGGTGACAGAATCAACATCGACTTCGATATTGCTAGATCTTTAATCGAT
GAAGTTATTCCCTACTCTCTTGAATACTTCCTTGGTATTAAGACTGGTGGTGAAGATCAC
GATGAAGAAATCGATATGGATGACCTCGATGAAGAAGAAATCGCCTAATTGCAAAAGGAA
TACGCTGCCAAGACTGGCAAGAAGGGTCCTGCTGCTGGTGGTGCTAACGATAAGAAGGAC
TGCAAGCAATAGTGA


>TTHERM_00786930(protein)
MSSETAAKHDHQNCEDHDHDHEEIDIDQQIEESIKELALGEKIRAVAINHHLAEKKALDE
ELQKKIQALTFEYEQKSMPIYAKTQEIVQGRVPTEEELKDLEKYLKEEEKTQVEGAKKEE
PITEYWLKAMKSNDVLAMEIKEQDETALKTLTKIEYVLEDTKKFHIVFTFGPNDYFTNTE
LKKTVELDENEEPVKTTGTPIEWKEGKNTTVKITKKTQKNKKTGVKRVVERETKIESFFN
FFSDSAPTDAPEEEDEEKDEQAMDGDRINIDFDIARSLIDEVIPYSLEYFLGIKTGGEDH
DEEIDMDDLDEEEIAQLQKEYAAKTGKKGPAAGGANDKKDCKQQ


>TTHERM_00786930(gene)
ATGTCTTCTGTAATTACATTAATTCATTTTTCAAAAACTGAAAAATCATTAATTATTTGT
AGTTGCTTACTTACCTTTTTCAATCTTAAAAATAGGAAACCGCCGCCAAGCACGACCACT
AAAACTGTGAAGATCACGATCACGATCACGAAGAAATCGACATCGATTAATAAATCGAAG
AATCCATCAAGGAATTAGCTCTTGGTGAAAAGATCAGAGCTGTTGCTATCAACCACCACC
TCGCTGAAAAGAAGGCCCTCGATGAAGAACTCTAAAAGAAGATCCAAGCCCTCACCTTCG
AATACGAACAAAAATCCATGCCCATCTACGCTAAGGTATATATTTATTTATAAACACTTT
AAGCTTTGCTTCGTTCAATTTTCAGCTTAACTCCTAAGCAAAAAATATGCAAATTCCAAA
ATTTTAAGTAGAGATGTCTCAGCAATACATTACATCTCCTAAGGAGAGCTAAGAACATTA
GCATGCCTAGCATAATATCTTTTTTTGAACATAAATTAATCTAATTTTTAAATATTAGAC
TCAAGAAATCGTTCAAGGTAGAGTTCCCACTGAAGAAGAATTGAAGGACTTAGAAAAGTA
CTTAAAGGAAGAAGAAAAGACTCAAGTTGAAGGTGCCAAGAAGGAAGAACCCATCACCGA
ATATTGGTTGAAGGCTATGAAGAGCAACGACGTTTTGGCTATGGAAATCAAGGAACAAGA
CGAAACTGCCTTAAAGACCCTTACCAAGATCGAATACGTTTTGGAAGATACCAAGAAGTT
CCACATCGTCTTCACTTTCGGTCCCAACGACTACTTCACCAACACTGAATTAAAGAAGAC
CGTCGAATTAGATGAAAACGAAGAACCTGTTAAGACCACCGGTACTCCCATTGAATGGAA
GGAAGGAAAGAACACCACCGTCAAGATCACCAAGAAGACCCAAAAGAACAAAAAGACTGG
TGTCAAGAGAGTCGTTGAAAGAGAAACCAAGATCGAATCTTTCTTCAATTTCTTCTCTGA
CTCTGCTCCCACTGATGCCCCCGAAGAAGAAGACGAAGAAAAGGACGAACAAGCCATGGA
CGGTGACAGAATCAACATCGACTTCGATATTGCTAGATCTTTAATCGATGAAGTTATTCC
CTACTCTCTTGAATACTTCCTTGGTATTAAGACTGGTGGTGAAGATCACGATGAAGAAAT
CGATATGGATGACCTCGATGAAGAAGAAATCGCCTAATTGCAAAAGGAATACGCTGCCAA
GACTGGCAAGAAGGGTCCTGCTGCTGGTGGTGCTAACGATAAGAAGGACTGCAAGCAATA
GTGA