Identifiers and Description

Gene Model Identifier

TTHERM_00637360

Standard Name

NAF1 (Nuclear Assembly Factor)

Aliases

PreTt19739 | 91.m00154

Description

NAF1 domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.4%

TetraMine Data

TTHERM_00637360

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03553.11.9991691033935208e-179NAF1 domain-containing protein
(547 aa)
OxytrichaContig11754.0.g930.000000000000006999063783600386Gar1/Naf1 RNA binding region
SGDYNL124W0.0000000010002658722841845NAF1 RNA-binding protein requi
red for the assembly of box H/
ACA snoRNPs and thus for pre-r
RNA processing, forms a comple
x with Shq1p and interacts wit
h H/ACA snoRNP components Nhp2
p and Cbf5p; similar to Gar1p
WormBaseWBGene000091320.000008000552149328928status:Confirmed UniProt:Q19
788 protein_id:CAA93283.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00637360(coding)
ATGGATCAAGAAGATATATAATAGTAATTCTCTTAAGAAAATTAGAATATTTAGTTTGTT
AATACAAATACTACATCTAACATTTTACCCATCACTGTTTAGAATTCAGAGTAGCTAAAC
ATAGAAAATTAGCAGGATCCTACAACTCTGTAAGCTGATAACTAAAAATAGGTAACATAC
TACTTTAGGGATTCAGACTAATCTGAATGGAGTTCAAGTGAAAGTGAGGGAGAAGATAAT
TAAAATGAAGACAACTTATAAGAAAATTAAATTGAATAAGAAGAAAATAATATGGAAAAT
GATTAAGCTAATAAAAAGAAGAAAAATAAAAATAAGAATACCAAAAAATATGATGAAGAT
TTTTTTGAAGAAGAGGATATTGTAATTGATCCTAAAGGTGAATAAATGAAAACCAAAAAT
GAAGCAAAGCCTTAAAAGTATGAAAAGTTTGAATCAGACATGGAAAGACTTGTAAGATTT
GGAGTTTAATTTAAAGGAAACGAGGTTTTGGTAGAGCTTGGATAAATTATGACTATAGTA
GATGACAAGATCATTATTGCTACTAACAATGAAATGAGAGAAGCAGAAAAAAGAATCATT
GTTGACCTCGACAATATTATATTTAATGAATAAAAAAATATTATTGGAAATGTAGATGAT
GTATTTGGAAATATTAAAAATCCATTTTATTGTGTTATTATAGACAAATACACTGAGGAA
ATGATAGCTTAGAAGAGATTATAAGTAGGTTAAAAAGTTTATATGATTGAAGGTTATAAT
AAGTTGTTAATGAAAGCCTAATTAGAATTCCTGTTAAGATAAAAAGGATGCGATGCTTCA
AATAGATTTGATGAAGAAGTGCTAAATGACAATGAAATAGAGTATTCAGATGATGAAATG
GAGTCAAAAGCTAAAACTAAAAGAAATAACAAAGAGAGAAAATAAGATTTGGAAGATGTA
GAAGAAGAAGTTAGAAATGAAGAAAAGCAAAATCCTATTAAATAAAAGAAGAATAAGAAA
ATTATGGTCATGAAAAATGAAAATGGTGTTTTAAAAAGAATATTTTTAAAGCCTTCTGAG
TTTGAAAGCTTGAAAAATAATCCTAATAACAAGATACAGCAGCTTCCATCAGGATATAAT
CCAAATAAATTCCCTAAAGGTGGTAATCCAAATAATTAATAGTAATAATTCAGTATTCCA
AGTGGATAAAATCCTCACTATTAGAAGCCCAACTATTAATAAAATAAATAATATAGGCCA
AATAATAATCCAAATTATTAGAAATAAAACTACTATTAGAATTAGCAAAATTATTAAGGA
TAGCAATCTTCTTAAAATTATTAATACTAGCAATAAACTCCATTTACAAATTACTAAAAC
TAATAACAATAATATGGCTATCAAAATTAATAGCAGTTTAATCAAATTCCCTAGCAATAG
TAGTAATATTATCAAAATAATGATTACTAATAAAATTAATAAAATAATTAAGACCAAAAT
TTCTAAAATTAAAACAACTATTAAAACTTTAACAATATGTAGCAATAATAATAGCACTAC
CAATAATCACCTTAAAATTTTCAATAAAACAATTAAATGAATTGA


>TTHERM_00637360(protein)
MDQEDIQQQFSQENQNIQFVNTNTTSNILPITVQNSEQLNIENQQDPTTLQADNQKQVTY
YFRDSDQSEWSSSESEGEDNQNEDNLQENQIEQEENNMENDQANKKKKNKNKNTKKYDED
FFEEEDIVIDPKGEQMKTKNEAKPQKYEKFESDMERLVRFGVQFKGNEVLVELGQIMTIV
DDKIIIATNNEMREAEKRIIVDLDNIIFNEQKNIIGNVDDVFGNIKNPFYCVIIDKYTEE
MIAQKRLQVGQKVYMIEGYNKLLMKAQLEFLLRQKGCDASNRFDEEVLNDNEIEYSDDEM
ESKAKTKRNNKERKQDLEDVEEEVRNEEKQNPIKQKKNKKIMVMKNENGVLKRIFLKPSE
FESLKNNPNNKIQQLPSGYNPNKFPKGGNPNNQQQQFSIPSGQNPHYQKPNYQQNKQYRP
NNNPNYQKQNYYQNQQNYQGQQSSQNYQYQQQTPFTNYQNQQQQYGYQNQQQFNQIPQQQ
QQYYQNNDYQQNQQNNQDQNFQNQNNYQNFNNMQQQQQHYQQSPQNFQQNNQMN


>TTHERM_00637360(gene)
ATGGATCAAGAAGATATATAATAGTAATTCTCTTAAGAAAATTAGAATATTTAGTTTGTT
AATACAAATACTACATCTAACATTTTACCCATCACTGTTTAGAATTCAGAGTAGCTAAAC
ATAGAAAATTAGCAGGATCCTACAACTCTGTAAGCTGATAACTAAAAATAGGTAACATAC
TACTTTAGGGATTCAGACTAATCTGAATGGAGTTCAAGTGAAAGTGAGGGAGAAGATAAT
TAAAATGAAGACAACTTATAAGAAAATTAAATTGAATAAGAAGAAAATAATATGGAAAAT
GATTAAGCTAATAAAAAGAAGAAAAATAAAAATAAGAATACCAAAAAATATGATGAAGAT
TTTTTTGAAGAAGAGGATATTGTAATTGATCCTAAAGGTGAATAAATGAAAACCAAAAAT
GAAGCAAAGCCTTAAAAGTATGAAAAGTTTGAATCAGACATGGAAAGACTTGTAAGATTT
GGAGTTTAATTTAAAGGAAACGAGGTTTTGGTAGAGCTTGGATAAATTATGACTATAGTA
GATGACAAGATCATTATTGCTACTAACAATGAAATGAGAGAAGCAGAAAAAAGAATCATT
GTTGACCTCGACAATATTATATTTAATGAATAAAAAAATATTATTGGAAATGTAGATGAT
GTATTTGGAAATATTAAAAATCCATTTTATTGTGTTATTATAGACAAATACACTGAGGAA
ATGATAGCTTAGAAGAGATTATAAGTAGGTTAAAAAGTTTATATGATTGAAGGTTATAAT
AAGTTGTTAATGAAAGCCTAATTAGAATTCCTGTTAAGATAAAAAGGATGCGATGCTTCA
AATAGATTTGATGAAGAAGTGCTAAATGACAATGAAATAGAGTATTCAGATGATGAAATG
GAGTCAAAAGCTAAAACTAAAAGAAATAACAAAGAGAGAAAATAAGATTTGGAAGATGTA
GAAGAAGAAGTTAGAAATGAAGAAAAGCAAAATCCTATTAAATAAAAGAAGAATAAGAAA
ATTATGGTCATGAAAAATGAAAATGGTGTTTTAAAAAGAATATTTTTAAAGCCTTCTGAG
TTTGAAAGCTTGAAAAATAATCCTAATAACAAGATACAGCAGCTTCCATCAGGATATAAT
CCAAATAAATTCCCTAAAGGTGGTAATCCAAATAATTAATAGTAATAATTCAGTATTCCA
AGTGGATAAAATCCTCACTATTAGAAGCCCAACTATTAATAAAATAAATAATATAGGCCA
AATAATAATCCAAATTATTAGAAATAAAACTACTATTAGAATTAGCAAAATTATTAAGGA
TAGCAATCTTCTTAAAATTATTAATACTAGCAATAAACTCCATTTACAAATTACTAAAAC
TAATAACAATAATATGGCTATCAAAATTAATAGCAGTTTAATCAAATTCCCTAGCAATAG
TAGTAATATTATCAAAATAATGATTACTAATAAAATTAATAAAATAATTAAGACCAAAAT
TTCTAAAATTAAAACAACTATTAAAACTTTAACAATATGTAGCAATAATAATAGCACTAC
CAATAATCACCTTAAAATTTTCAATAAAACAATTAAATGAATTGA