Identifiers and Description

Gene Model Identifier

TTHERM_00686140

Standard Name

NAA50 (N-alpha-acetyltransferase 50)

Aliases

PreTt18228 | 104.m00160 | 3732.m00073

Description

acetyltransferase, GNAT family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00583 ) acetyltransferase, GNAT family
  • ( TIGR01575 ) ribosomal-protein-alanine acetyltransferase

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.6%

TetraMine Data

TTHERM_00686140

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17401.12.000043494209831e-96acetyltransferase, GNAT family
protein (155 aa)
OxytrichaContig1188.1.g661.0002335610448659e-38Peptidase family M3
DictyBaseDDB_G02957212.0003218023735366e-33naa50 on chromosome: 3 positio
n 183263 to 183872
WormBaseWBGene000182385.997292208647762e-33status:Confirmed UniProt:Q20
220 protein_id:CCD70147.1
Stentor CoeruleusSteCoe_130380.00000000000003442477108469977
SGDYPR131C0.000005000363240844623NAT3 Catalytic subunit of the
NatB N-terminal acetyltransfer
ase, which catalyzes acetylati
on of the amino-terminal methi
onine residues of all proteins
beginning with Met-Asp or Met
-Glu and of some proteins begi
nning with Met-Asn or Met-Met

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00686140(coding)
ATGTCAGAAATAAAAGTTTAATTTGGTGACGTTAATGAAAAAAATTATGAATTGTTAAGA
ACTTTGAATTCTGTAACATTCCCAGTTTAGTACACTTTATCATTTTACAATAAGGTGTTG
ACTTATAACAAATACTCAAGGTTAGCTTTTTATAATGATATTCTTGTTGGAGCTATGACA
TGCAGACAAGAAGAAAAGGATGGATAATAAAGTCTTTATATTTTAACTATTGGAGTATTA
GATGCCTATAGAAAGCATAAAATTGGATCACAATTGATGGACGAATTATTAAAATTAGTT
AAACAAGATCCAGAAATTAAGTTTATTTATTTACACATGTAAGTGAACAACGAAGTTGGT
CTATAGTTTTACAAAAGATTTGGATTTGAAATTGCAGAAACTATAGATAATTATTACACT
GATATTAGTCCTAAAGCCTGTTATATTTTGAAAAAGATGCTTTGA


>TTHERM_00686140(protein)
MSEIKVQFGDVNEKNYELLRTLNSVTFPVQYTLSFYNKVLTYNKYSRLAFYNDILVGAMT
CRQEEKDGQQSLYILTIGVLDAYRKHKIGSQLMDELLKLVKQDPEIKFIYLHMQVNNEVG
LQFYKRFGFEIAETIDNYYTDISPKACYILKKML


>TTHERM_00686140(gene)
ATGTCAGAAATAAAAGTTTAATTTGGTGACGTTAATGAAAAAAATTATGAATTGTTAAGA
ACTTTGAATTCTGTAACATTCCCAGTTTAGTACACTTTATCATTTTACAATAAGGTGTTG
ACTTATAACAAATACTCAAGGTTAGGTAAATAGCAGACATATTCATACATGAAATATTTC
AAATTATTAACTTCTACCAAGAAAATTAGCAAAATATTCATATTATTAATTAAGCAAAAT
ACCATTAATAATATTTCATTATTAACTCAATTCAAAATACTTATTCATATATTTAAAAAC
CGTTTTTATAATGATTATATCAATTTATTTTAATTATTTCTAGCTTTTTATAATGATATT
CTTGTTGGAGCTATGACATGCAGACAAGAAGAAAAGGATGGATAATAAAGTCTTTATATT
TTAACTATTGGAGTATTAGATGCCTATAGAAAGCATAAAATTGGTAATATATTCATTTTT
ATATAAACAATTAAAAGATATGTTTTTTTATAATTAAACTAATCCATAATTAATAAAATT
ATTATAGGATCACAATTGATGGACGAATTATTAAAATTAGTTAAACAAGATCCAGAAATT
AAGTTTATTTATTTACACATGTAAGTGAACAACGAAGTTGGTCTATAGTTTTACAAAAGA
TTTGGATTTGAAATTGCAGAAACTATAGATAATTATTACACTGATATTAGTCCTAAAGCC
TGTTATATTTTGAAAAAGATGCTTTGA