Identifiers and Description

Gene Model Identifier

TTHERM_00202930

Standard Name

MybL2 (Myb-like-2)

Aliases

PreTt13765 | 17.m00372

Description

Myb-like DNA-binding domain

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( TIGR01363 ) streptococcal histidine triad protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.5%

TetraMine Data

TTHERM_00202930

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16701.19.997093137033517e-262hypothetical protein (681 aa)
OxytrichaContig19769.0.g914.0006511639687014e-23Myb-like DNA-binding domain
DictyBaseDDB_G02887830.00000000000009996062864481225mybG on chromosome: 5 position
1962158 to 1963568

General Information

Paragraph NoGene NameParagraph Text
148MybL2MybL1 was detected as a high-confidence interaction partner of RebL1 and Anqa1 conjugation (Nabeel-Shah et al. 2021).

Associated Literature

  1. Ref:34086947: Nabeel-Shah S, Garg J, Saettone A, Ashraf K, Lee H, Wahab S, Ahmed N, Fine J, Derynck J, Pu S, Ponce M, Marcon E, Zhang Z, Greenblatt JF, Pearlman RE, Lambert JP, Fillingham J (2021) Functional characterization of RebL1 highlights the evolutionary conservation of oncogenic activities of the RBBP4/7 orthologue in Tetrahymena thermophila. Nucleic acids research ( ):

Sequences

>TTHERM_00202930(coding)
ATGACTACAAAGGACAATAAATAAAGCTGCTAGAGTTCCACTAGCGATGAAAATAGCATT
CATAATTAGGTATTACTCCTACAATAACTTAACAACGCTAATAACAGCATGTATTCAGCT
TCTCCTAGAGCTAATCAGCTCTCCTCAGTCTAGGCTGGTAGCCTAGCTGCTAGTGGCTGC
GATGCATTCTAATAAAATGCTTCTGCCCATTCCAAGGCTGCTGGTGTTAATGCTTAATCT
TCTTCAGCTGCTTCCTAACATGGCAGATGGACTAAAGAAGAGCACCAAAAATTCCTCGAA
GGACTCAATATCTACGGAAAGAATTGGAAGAAGGTAGAGGAGCACATTGGAACTAGAACA
GGCGCTTAAATTCGTTCTCATGCCTAAAAGTTCTTTAACAGACTCGAAAAAGAGTTTGGA
AAGACAAATGTCACTAAGGATTTGAATGCAAATAGCGCCTCAGCTTAGCAAAGCCAGCAA
ATACAACAACAAAAATAACAAAATCAAATCTCAAGCAGCTAAGCAAATTCTTCGTTACCA
AATCAAATTCATTCACTTTAATAGAATGCTCCAACCCAGCAACTTAACTTCGCCTCAGCT
ATCTAATCCGACTACGCTAAGCACCTACTAAAAAACGAAAGACAGTAAGATTTCTATGAA
GATATGACTCCTATGATATCACATTTGAATAGCTCACCTGAATCAGGCGACATCCTTTAA
AATCCCTTGCATTTGATTTCATAAAACAACTCTGCTTCTATTAACATTAAGCCTGTTTTA
GACTCATCAATTGATGGAGCTCCAAAGAAAAAGAATTGGAGTTAAATCTTAAGCGCTTAG
GAGAAAATGAAATAGTAAGCATTAAATAGCAATAACAGCATATTAGGAACAGCTAACTAG
AACGTGTTAAGCAAAAAGGAGAAGAAATTTCTCTCTAAAAATGAAAAAAGAATAACTGAT
TAATTAAGCTAATTACTTGATCAGCAATGCTAGCACTTAACTTAAAATATTCCTTATGAG
AACTAAGCAAATAAGGAAGTAGATTTTGATTCATTCAATAACAACGGAGTCGATTAAGAA
GTCTCCCCAAGCGATTTCATCAGTCAATCTCTTCTAAACTCAATTTTCGAGCCAGCTGAT
ATTGAAACTCATCTTATTTAGTTCTACATTGCGCAAATGAATCTTGAATAACTTATTAGT
TAAAAGAAATAGTATGACTTAAATGAGGTATCTCCTTACATGCAAAATCAAATTAAGAAA
AAGAAATTATCGATTGATTCAATTAGCACTAGCGGTGGAAATAACATGAATTTTGTTAAT
AACTTAGCTAATAATTTGGACAATATCAGCACCTCTTAGTTAAGCCACTCAACTGGAATT
TCAGCCACTTCTCCTTCTTCTTCTGCTTTTTCAGCTGCTCGTCTTAGCTAAAACAAGATC
GCTCAACCATAACCCAACAACTTCGCAGCTGTATAATAAAACCGTAATCAGAATATTTAA
AAGAATCAACTCAGAAACTCAGTGCCAAAGTAAGCAAATGAAGATATCAGTTAAATCTCA
GAATATCAATAATCCTTATTATTATTCAATCTCTTGCAAGGATTGACCAACTCATAACAA
TAGAACTAACCAACTGAGGATCTCTAAAAGAATAGCAGAAAACAGGCCATTAAAGAAGCT
ACTCCTAAATTCAACTAACCATCTGCTGTAAATAATAGTTCTCAGAACTAAGATTAATCT
GATGAAGTTGAGCTTTTCAAGCATTTGTTAGTAAACCTTTAATAAAGACAAGCCAATTAA
TTCAATTAAAGCTATCCAAATCAAAGCATCCTTTCTTAAAAGCAAGGCTCTAGTACAAAT
GCAAATTTCAAAACCCCATCACTACCTAACACATTCAATGCCAAGAACGATTAGACATCA
TTGAATTTCATGTCAACAGAAGAAGAGGAGGATGATGACAACAGTAGCTTCGACTTAATT
TAAAAGCAATTAATGCAATTCATTGCCCCTCAAAAATAAACCATAGAACAAAACCCTAGT
CTATAACTCTTAAATGCCTTGAAGAATGGTCATTTTTGA


>TTHERM_00202930(protein)
MTTKDNKQSCQSSTSDENSIHNQVLLLQQLNNANNSMYSASPRANQLSSVQAGSLAASGC
DAFQQNASAHSKAAGVNAQSSSAASQHGRWTKEEHQKFLEGLNIYGKNWKKVEEHIGTRT
GAQIRSHAQKFFNRLEKEFGKTNVTKDLNANSASAQQSQQIQQQKQQNQISSSQANSSLP
NQIHSLQQNAPTQQLNFASAIQSDYAKHLLKNERQQDFYEDMTPMISHLNSSPESGDILQ
NPLHLISQNNSASINIKPVLDSSIDGAPKKKNWSQILSAQEKMKQQALNSNNSILGTANQ
NVLSKKEKKFLSKNEKRITDQLSQLLDQQCQHLTQNIPYENQANKEVDFDSFNNNGVDQE
VSPSDFISQSLLNSIFEPADIETHLIQFYIAQMNLEQLISQKKQYDLNEVSPYMQNQIKK
KKLSIDSISTSGGNNMNFVNNLANNLDNISTSQLSHSTGISATSPSSSAFSAARLSQNKI
AQPQPNNFAAVQQNRNQNIQKNQLRNSVPKQANEDISQISEYQQSLLLFNLLQGLTNSQQ
QNQPTEDLQKNSRKQAIKEATPKFNQPSAVNNSSQNQDQSDEVELFKHLLVNLQQRQANQ
FNQSYPNQSILSQKQGSSTNANFKTPSLPNTFNAKNDQTSLNFMSTEEEEDDDNSSFDLI
QKQLMQFIAPQKQTIEQNPSLQLLNALKNGHF


>TTHERM_00202930(gene)
ATGACTACAAAGGACAATAAATAAAGCTGCTAGAGTTCCACTAGCGATGAAAATAGCATT
CATAATTAGGTATTACTCCTACAATAACTTAACAACGCTAATAACAGCATGTATTCAGCT
TCTCCTAGAGCTAATCAGCTCTCCTCAGTCTAGGCTGGTAGCCTAGCTGCTAGTGGCTGC
GATGCATTCTAATAAAATGCTTCTGCCCATTCCAAGGCTGCTGGTGTTAATGCTTAATCT
TCTTCAGCTGCTTCCTAACATGGCAGATGGACTAAAGAAGAGCACCAAAAATTCCTCGAA
GGACTCAATATCTACGGAAAGAATTGGAAGAAGGTAGAGGAGCACATTGGAACTAGAACA
GGCGCTTAAATTCGTTCTCATGCCTAAAAGTTCTTTAACAGACTCGAAAAAGAGTTTGGA
AAGACAAATGTCACTAAGGATTTGAATGCAAATAGCGCCTCAGCTTAGCAAAGCCAGCAA
ATACAACAACAAAAATAACAAAATCAAATCTCAAGCAGCTAAGCAAATTCTTCGTTACCA
AATCAAATTCATTCACTTTAATAGAATGCTCCAACCCAGCAACTTAACTTCGCCTCAGCT
ATCTAATCCGACTACGCTAAGCACCTACTAAAAAGTAATACATTTCCCAATCATGCTTCT
AAAATTACACACATTCTGCTCCAACCCATTTATATTTTTAAATTTGAAGAGTGAAAAATA
CTTTTACAACTCCTAAAGCTCTAAAAGTCAATTGATTTGTTAATTAATTTTTCTTATTCC
CTTTCTTGTTCTTTTATAGATCTTACTAAGATACAAACAATTAATCACTCTATCAATTAT
TCAAAGATAAATAACAAATTGCAAATCTATCAATCGCCTCATTTATTCATCCGCTTTCTC
ATTCAATCGTTTCTCTATTCATAGTTTGATTAATTGATATATGCAGTCAGTGATAGAGTG
GAAATAGAATTATAATTTACTAGATTAATTCATTGATCAAAAGCATCTTTAAAGAATTTA
AACTATTCTATTTCTTATAAGCTTATCAGACACTGATTACTTGTTATATACTTAGAAGAG
AAAGGGAAGTGAGAGGATTGTTAGGTTTCATTTATTGGCTCTAAAATTAAACTTGAGTTA
AACCAAACAGATTATTTCATAATTTAAAATGAGCAAACAAGCGTAAAGTACGCTATTAAT
TGGGGTTGTGTTATTTTTAATTGAGCAGCAAATATAGTTTTAAAAAGTTATACTTTCTAA
CACATTTTTAAACTTTTTTTACATAAATAGACGAAAGACAGTAAGATTTCTATGAAGATA
TGACTCCTATGATATCACATTTGAATAGCTCACCTGAATCAGGTAATTTTTAAATTAAGG
CCTTCTTCAAATTAAAGCGAGAATAATAGAAAATTATTGAACCAAGTTTAAGATCCAAAT
TACAGTTCATTTAAACGGCACTCATTTTACATTTATACACATAAGAGAACATTAAAATAG
AATTCATTTCCTGTATAGTATTCTAACAAATAAATTCAATCAATCTAAAAATTAGAAGAG
AAAAAAATCTAATGTTAAATCAGTACTTAAAAACATTTCATTAATAATTAATTAAATTAA
GAAAGAGAAAACCAGATGATAAGTATAATAATCAACATTAGCAAGTATTATTCCAAAATA
GAATTCTCATATAACAAAAAACATCTTTGATTCTTAATGATTGAATTGATACATATTGAG
AAGGATATTTAAAATATTTACTACAGTTTAAAATTGATAAATGCTTCTAAAGTATTTTTC
AAATTGATAAAATATAAACCTTTCTTTGGTTTGTTTGGAGTTTAGTTATATAAAGTATAG
AAATTTATAATTTTTAGATTGAATGGATTTAAATTTTTAAAAATTAGTTAGAAAGTATTT
GAAAGATTTTATCAAGATTGATTTGATTGTTAGATAATATTGATTGATAGAGAGAAAGAG
AGATTGTGACTGATTCAAATTTTAGAATCTGAACAAAAATTTTTTTTTGAGTTATCTCTT
TATTATCAAGATGTAATCTTATCCAAGCATTTTGGCTCATAAATATCTTTTACAAATTTT
TTGAAATTTTTCAATCTTTCTAAAGTTTCATAGAAATAAAGATTTTCTAATTTGAAGGAA
TTAGTAAGAGTGCTTCAAAGATTTTTTGATAAATGTAAATGAACTAATAATTTCATGAGC
CATTCATAAAGAAATAATTTAATTATTATTAAATGACTGATTTGCGATTATTCGAAATGT
GATAACAAAAATTAAAACACCCATTTATTAATTACATCTAATCCCGCTTTATTACTAAAT
TTGATTTTTTTATAATATTAAATTTTATTTTTTTGAATTATATCTAGGCGACATCCTTTA
AAATCCCTTGCATTTGATTTCATAAAACAACTCTGCTTCTATTAACATTAAGCCTGTTTT
AGACTCATCAATTGATGGAGCTCCAAAGAAAAAGAATTGGAGTTAAATCTTAAGCGCTTA
GGAGAAAATGAAATAGTAAGCATTAAATAGCAATAACAGCATATTAGGAACAGCTAACTA
GAACGTGTTAAGCAAAAAGGAGAAGAAATTTCTCTCTAAAAATGAAAAAAGAATAACTGA
TTAATTAAGCTAATTACTTGATCAGCAATGCTAGCACTTAACTTAAAATATTCCTTATGA
GAACTAAGCAAATAAGGAAGTAGATTTTGATTCATTCAATAACAACGGAGTCGATTAAGA
AGTCTCCCCAAGCGATTTCATCAGTCAATCTCTTCTAAACTCAATTTTCGAGCCAGCTGA
TATTGAAACTCATCTTATTTAGTTCTACATGTAAATAACTAATTTAAAAATTTTTCCATT
TTAAATAAATCAATAAATCACAAAAACGGTTTTTGATACTTAAGAGAGAAAAATCAAACT
TTACTTTCCAAATCCAAATCCAAATTTCCTAAATTTGAATAAAGATGTTAAAAAAGAAAA
AAAATTGATGAGATTTCATCTAAATAAATAATAAAAGCGCATGTTTGGATTATAAGTTAA
TATTTTTAATGCAGTAAAAGGAAGCGATTTTTCATTATCTTTCTTAGAATTTATGGAAAT
TTAAATGAAGTGATAAATTTAAAAAGATCTTGAAAAGCATTTTTACTTAAAAAATAAATT
GGGTGAAATTAAAATCTAATTTTTTTTGAAGATTTGAAAAATGTTGCTCTTTTGGTAATA
AAATAAAGCGGTAAAGAGATAAGTCCCTTTTTTAAATATATTTTTGAAAATATGTTTAAA
AAATATCAAAGCAATTTTCAAATTTTATGAGATCCTCAGATTTTGTTTGTTAAGCAATAA
ATTAATAAATCTTTCAATCAATCTTTAAAAAAAAACCCAAAATTTCACAAAATTCTTATT
CGAAAAATTTAAATCATCCCAAAGAAGATTTTTGAAGAATCTTTAGAATTTTTTTCAATT
ATTTGCCCGCAAATATCTTTAAGGATATCTTTTGAAATTATTAAATGCGTAATAAATCTT
TTACAAAATCTATTTCTTTTTTCTAGAAATGATTAATATCTTTTTGTTATGATCAATCAA
TCAATCAAGCATTTATCTTAAAATATAAAGATAAGTTTAATGCCTTTATGATTTTATTTC
AATAGTATAATTAAATAAAATAATAAGTTACAAATTACACCAGTATCAATCAAAATAACG
ATTGAATATAATAAGATTGATTTAATTTCTAAATGTTAAGTTTTTTTGTCGAGTTAATTA
ATGTAAATAAAATAGAGCATATATTTAAGATATTGTATTTTTTTTAAGATGACGAAGATA
AACAAGTATTAACGTTTTGGTGATAATATTTGATGATAGATGATTTTGAAATAGACAAAT
ATCTATATTAAAAACAAATATTAATTATTATTATTTAAAAATAGTGCGCAAATGAATCTT
GAATAACTTATTAGTTAAAAGAAATAGTATGACTTAAATGAGGTATCTCCTTACATGCAA
AATCAAATTAAGAAAAAGAAATTATCGATTGATTCAATTAGCACTAGCGGTGGAAATAAC
ATGAATTTTGTTAATAACTTAGCTAATAATTTGGACAATATCAGCACCTCTTAGTTAAGC
CACTCAACTGGAATTTCAGCCACTTCTCCTTCTTCTTCTGCTTTTTCAGCTGCTCGTCTT
AGCTAAAACAAGATCGCTCAACCATAACCCAACAACTTCGCAGCTGTATAATAAAACCGT
AATCAGAATATTTAAAAGAATCAACTCAGAAACTCAGTGCCAAAGTAAGCAAATGAAGAT
ATCAGTTAAATCTCAGAATATCAATAATCCTTATTATTATTCAATCTCTTGCAAGGATTG
ACCAACTCATAACAATAGAACTAACCAACTGAGGATCTCTAAAAGAATAGCAGAAAACAG
GCCATTAAAGAAGCTACTCCTAAATTCAACTAACCATCTGCTGTAAATAATAGTTCTCAG
AACTAAGATTAATCTGATGAAGTTGAGCTTTTCAAGCATTTGTTAGTAAACCTTTAATAA
AGACAAGCCAATTAATTCAATTAAAGCTATCCAAATCAAAGCATCCTTTCTTAAAAGCAA
GGCTCTAGTACAAATGCAAATTTCAAAACCCCATCACTACCTAACACATTCAATGCCAAG
AACGATTAGACATCATTGAATTTCATGTCAACAGAAGAAGAGGAGGATGATGACAACAGT
AGCTTCGACTTAATTTAAAAGCAATTAATGCAATTCATTGCCCCTCAAAAATAAACCATA
GAACAAAACCCTAGTCTATAACTCTTAAATGCCTTGAAGAATGGTCATTTTTGA