Identifiers and Description

Gene Model Identifier

TTHERM_000727749

Standard Name

MZT1 (Mitotic-spindle organizing protein)

Aliases

None

Description

mitotic-spindle organizing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.5%

TetraMine Data

TTHERM_000727749

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17928.12.0000236365077126e-43hypothetical protein (82 aa)
OxytrichaContig18757.0.g515.0013199114200274e-20Mitotic-spindle organizing gam
ma-tubulin ring associated
Stentor CoeruleusSteCoe_348760.00000000000009357622968840175

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_000727749(coding)
ATGAATTATTCTTATAATCCAAGCGCAATAAGCTAAAATAATGCTGATATAGAGGAAGCT
AAAGAAACTCTAGAAATCTTATATGATATAAATTAAATATTAAATTGCGGTTTAGATAGA
TAATAGCTTTCTGTGCTTATCAGTTTGTGCGAAAATGGAATAAATCCTGAAGCCTTAGCT
GCTGTTGTGAAAGAATTAAGAAAAGAGGCTGCTGCTTTAAAAGTAATTTAAAATAATTCT
TAAAATTGA


>TTHERM_000727749(protein)
MNYSYNPSAISQNNADIEEAKETLEILYDINQILNCGLDRQQLSVLISLCENGINPEALA
AVVKELRKEAAALKVIQNNSQN


>TTHERM_000727749(gene)
ATGAATTATTCTTATAATCCAAGCGCAATAAGCTAAAATAATGCTGATATAGAGGAAGCT
AAAGAAACTCTAGAAAGTATTTTCAATTACAGATATTTTTTTTTCATTAGTTGAAATAAA
AATTAACTTAATAATAATATAGTCTTATATGATATAAATTAAATATTAAATTGCGGTTTA
GATAGATAATAGCTTTCTGTGCTTATCAGTTTGTGCGAAAATGGAATAAATCCTGAAGCC
TTAGCTGCTGTTGTGAAAGAATTAAGAAAAGAGGCTGCTGCTTTAAAAGTAATTTAAAAT
AATTCTTAAAATTGA