Identifiers and Description

Gene Model Identifier

TTHERM_00145730

Standard Name

MYST1

Aliases

PreTt26781 | 11.m00478 | 3702.m00200

Description

MOZ/SAS family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

  • transferase activity, transferring acyl groups other than amino-acyl groups (IEA) | GO:0016747

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_00145730

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04699.19.997093137033517e-262hypothetical protein (466 aa)
OxytrichaContig14180.0.g373.001222955304439e-106MOZ/SAS family
DictyBaseDDB_G02750176.000988504514371e-99DDB_G0275017 on chromosome: 2
position 5183368 to 5185287
WormBaseWBGene000070292.0000012618802033e-84locus:mys-1 Histone acetyltr
ansferase Tip60 homolog stat
us:Confirmed UniProt:Q9TYU5
protein_id:CCD70078.1
SGDYOR244W7.003377498796081e-81ESA1 Catalytic subunit of the
histone acetyltransferase comp
lex (NuA4) that acetylates fou
r conserved internal lysines o
f histone H4 N-terminal tail;
required for cell cycle progre
ssion and transcriptional sile
ncing at the rDNA locus
Stentor CoeruleusSteCoe_226984.1863939993042314e-51

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00145730(coding)
ATGGCAGCTAAGAGAAAAGGAAAGGGGAAGGAAGCATTAGGAAAAGAATTAGGAGATAAA
AAGCAAATCTTAAACATAAATTTGAATTAGATTTATGAAGGTGCTCTTGATAGCAACTAT
TATGTTATTGCAACCATGAAGAATGGTTAAAAAGCTAAAGCAAGGATTATTGAATGTAGA
GAAAGTAAAGATTTTGATGGAAAAAAGGAAAGAAACGATTATTCATATGATTATTATTGT
CATTTTGAAGGATTCAATAGGAGAAATGACTAATGGGTAACACGAGCAAAAATAGAACTT
ACAAATGAACTATACTCGGATTAGCATCTTAAAAAAAAGAAAAAGGGAGAAGATTAGAAA
TAAGACAAAGAAGAGAATGATGAACATGAAGGCATGGATGAGGCTTCACTGCAGGCACAT
ATGATAGCTACTAAAGTGAAGACAATAGAAAGAATTTAAATTGGAAAATACTCATGTGAG
ACATGGTATTACTCTCCTTATCCAAAGGGATACCACAACTTAGAAGCTTTATATATATGT
GAGTTTTGCTTAAGTTTTTATATTACTCAAAATGAGCTTGATAGACACAAAAAAATATGC
AAATTAACCCACCCACCAGGTGATGAAATTTACAGAGATGACACAAGAAAATAATCTGTA
TCTATGTTTGAAGTTGATGGTAAAAAAAATTAGGTATATACTGAAAATCTTGGATATCTA
AGCAAGCTTTTCTTAGACCATAAGAACCTCTATTACAGTTTAGATCCTTTTTTGATATAT
GTTTTTTGTGAAAACGATGAAGAAGGCAGTCATATTGTTGGGTATTTTTCAAAATGGAAA
GAATGTCCTAATGGGTTTAACTTGTCCTGTATATTAGTACTTCCTTGTCATTAAAGAAAA
GGATATGGCAAATTTTTAATAAGTTTTTCATATGAACTCTCACTTATTGAGGGAAAGGTA
GGAACTCCAGAAAGACCTCTCTCTGATTTAGGAAGGGTGAGCTACTTGAGTTGGTGGTCA
CAAAGAATAATTGAATACATTAAATCAAAACCCGCTGATTTTAATTTTAGTATATAAGAT
ATAACAAGAGAGACTGGAATTATGGAAAAAGATATTATTTGGACTTGTGAATAAAAAAAT
ATGATAAAGTATGCATAAGGATAAGTCATTATATGCACTGACATGAATTATCTAAATAAA
ATTTACAAAGATGCTGGTTAACCTGGAGTTCCTGTTCATCCTCATTTGATGAGATGGATG
CCATTTAGATTTAAATGGGACAAAGAAGTATAAATTGCTACTTATTCTCAGTAATATTCT
GTAGACAAATTTTTGTAAGCACCTATAGAGTAATCAAACAGTCTATAGCAATAGAGTAAA
CCTAAGTTAACTCCAAAGCCACAGTGA


>TTHERM_00145730(protein)
MAAKRKGKGKEALGKELGDKKQILNINLNQIYEGALDSNYYVIATMKNGQKAKARIIECR
ESKDFDGKKERNDYSYDYYCHFEGFNRRNDQWVTRAKIELTNELYSDQHLKKKKKGEDQK
QDKEENDEHEGMDEASLQAHMIATKVKTIERIQIGKYSCETWYYSPYPKGYHNLEALYIC
EFCLSFYITQNELDRHKKICKLTHPPGDEIYRDDTRKQSVSMFEVDGKKNQVYTENLGYL
SKLFLDHKNLYYSLDPFLIYVFCENDEEGSHIVGYFSKWKECPNGFNLSCILVLPCHQRK
GYGKFLISFSYELSLIEGKVGTPERPLSDLGRVSYLSWWSQRIIEYIKSKPADFNFSIQD
ITRETGIMEKDIIWTCEQKNMIKYAQGQVIICTDMNYLNKIYKDAGQPGVPVHPHLMRWM
PFRFKWDKEVQIATYSQQYSVDKFLQAPIEQSNSLQQQSKPKLTPKPQ


>TTHERM_00145730(gene)
ATGGCAGCTAAGAGAAAAGGAAAGGGGAAGGAAGCATTAGGAAAAGAATTAGGAGATAAA
AAGCAAATCTTAAACATAAATTTGAATTAGATTTATGAAGGTGCTCTTGATAGCAACTAT
TATGTTATTGCAACCATGAAGAATGGTTAAAAAGCTAAAGCAAGGATTATTGAATGTAGA
GAAAGTAAAGGTAAATAGTATTTTTAATCCGAAATTTTATGAAATTTACAAAAATAATTA
TCAAATATAATAAAACAGAATTTTTTATAAGGTAAAATGATATCTTTAAAAATATTTTGA
TAAAGCAGCTAATTTAGGAGAAGTTTAGTTTAACAATATTTTTTATTATTTATCATATTT
AGATTTTGATGGAAAAAAGGAAAGAAACGATTATTCATATGATTATTATTGTCATTTTGA
AGGATTCAATAGGAGAAATGACTAATGGGTAACACGAGCAAAAATAGAACTTGTAATTTA
ATATTTAAATGCCTTTAATATTTTAGTTTGAAAAATGCCAAACTAACAAAGAATTAAAAA
AAGCTTCCATTTATAATAAAAAAAGAAATTGTTAATTTGATGAAATTAAAATTTACTATT
CATAAAATAGACAAATGAACTATACTCGGATTAGCATCTTAAAAAAAAGAAAAAGGGAGA
AGATTAGAAATAAGACAAAGAAGAGAATGATGAACATGAAGGTTATTATTATTTTTATTG
TTTATTTATTAAAAAGATCTCTACCTTTTTCATCTTTTTGACATACTGATAAAAGATAAA
ACTTAAACAATTTCTTTATCCATAATAATTGTTTATAATTAATTTAAAATACTTAATTTA
ACTTATTAAACTTTTTCTCATAAATTGAAAAACACAAAATAAATAACTATAATGTAATTA
AATATAAAGGCATGGATGAGGCTTCACTGCAGGCACATATGATAGCTACTAAAGTGAAGA
CAATAGAAAGAATTTAAATTGGAAAATACTCATGTGAGACATGGTATTACTCTCCTTATC
CAAAGGGATACCACAACTTAGAAGCTTTATATATATGTGAGTTTTGCTTAAGTTTTTATA
TTACTCAAAATGAGCTTGATAGACACAAAAAAATATGCAAATTAACCCACCCACCAGGTG
ATGAAATTTACAGAGATGACACAAGAAAATAATCTGTATCTATGTTTGAAGTTGATGGTA
AAAAAAATTAGGTATATACTGAAAATCTTGGATATCTAAGCAAGCTTTTCTTAGACCATA
AGAACCTCTATTACAGTTTAGATCCTTTTTTGATATATGTTTTTTGTGAAAACGATGAAG
AAGGCAGTCATATTGTTGGGTATTTTTCAAAAGTATTTATATTGAATATTTATTTATTGC
TTATGAATGTATTAAGATTTTAATTTATGATTAATTTAATTTGTAAAAACTAATAATTTA
GTGGAAAGAATGTCCTAATGGGTTTAACTTGTCCTGTATATTAGTACTTCCTTGTCATTA
AAGAAAAGGATATGGCAAATTTTTAATAAGTTTTTCATATGAACTCTCACTTATTGAGGG
AAAGGTAGGAACTCCAGAAAGACCTCTCTCTGATTTAGGAAGGGTGAGCTACTTGAGTTG
GTGGTCACAAAGAATAATTGAATACATTAAATCAAAACCCGCTGATTTTAATTTTAGTAT
ATAAGATATAACAAGAGAGACTGGAATTATGGAAAAAGATATTATTTGGACTTGTGTATG
TTTCTTTATTTATTATTATTTTTAACATTAAATAATTAACCTAATTTAAAATAGGAATAA
AAAAATATGATAAAGTATGCATAAGGATAAGTCATTATATGCACTGACATGAATTATCTA
AATAAAATTTACAAAGATGCTGGTTAACCTGGAGTTCCTGTTCATCCTCATTTGATGAGA
TGGATGCCATTTAGATTTAAATGGGACAAAGAAGTATAAATTGCTACTTATTCTCAGTAA
TATTCTGTAGACAAATTTTTGTAAGCACCTATAGAGTAATCAAACAGTCTATAGCAATAG
AGTAAACCTAAGTTAACTCCAAAGCCACAGTGA