Identifiers and Description

Gene Model Identifier

TTHERM_00327320

Standard Name

MYO9 (MYOsin )

Aliases

PreTt30235 | 33.m00247 | 3705.m00075

Description

Myosin heavy chain; member of proposed myosin Class XX, distinct from previously defined myosin classes; contains predicted coiled-coil, myosin tail homology (MyTH4), and FERM domains

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.8%

TetraMine Data

TTHERM_00327320

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_08576.19.997093137033517e-262unconventional myosin heavy ch
ain (1572 aa)
OxytrichaContig18292.0.g1087.00277717908239e-127Myosin head (motor domain)
DictyBaseDDB_G02744559.0044753715726e-126myoI on chromosome: 2 position
4534415 to 4541848
SGDYAL029C7.997392158323398e-113MYO4 One of two type V myosin
motors (along with MYO2) invol
ved in actin-based transport o
f cargos; required for mRNA tr
ansport, including ASH1 mRNA,
and facilitating the growth an
d movement of ER tubules into
the growing bud along with She
3p
WormBaseWBGene000020354.0002634815779907e-110locus:hum-1 status:Confirmed
UniProt:Q19901 protein_id
:CAB00095.1

General Information

Paragraph NoGene NameParagraph Text
10MYO1,
MYO12,
MYO11,
MYO10,
MYO9,
MYO4 ,
MYO5,
MYO4,
MYO3,
MYO2,
MYO13
Proteins of the myosin superfamily are ATP-dependent molecular motors that travel unidirectionally along actin filaments. The myosin heavy chain proteins are comprised of three domains: a head (motor) domain responsible for ATP hydrolysis at the N-terminus, a neck (lever arm) region, and a C-terminal tail region. Thirteen predicted myosin heavy chain genes have been identified in the Tetrahymena genome and named MYO1-MYO13. A phylogenetic analysis comparing these predicted proteins with the 19 previously identified myosin classes suggests that Myo1p-Myo12p belong to a previously undescribed class of myosins. This new family, designated Class XX, does not include Myo13p, which did not branch with this class or any of the other classes in the analysis. The neck and tail regions of the Tetrahymena myosins include a variety of domains characterized in other myosin classes, with each protein containing one or more of the following domains: coiled-coil (which may support dimerization); IQ motif (binding sites for calmodulin or calmodulin-like proteins); FERM domain (Four-point-one protein, Ezrin, Radixin, Moesin homology); and MyTH4 domain (Myosin Tail Homology 4).

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00327320(coding)
ATGGATATCGAAAATTAAATAAGCGATGATTCAAAAACATATGATGACATGGTTGAGATG
GCCGTGTTAAATTAATCTGAAATTCTAAAAAATGTATCAACTCGTTACAAGCAAGATAAA
ATATTTACATTGATAGGACCTACTTTAATTGTGATGAATCCATATAAATAAATAAGCAAT
TTATTTGATGATTAAGTAATGCAGATGATATCTGAATAGGCTAAATAAAAACAGGAAATG
ATCAATTTATAGTAATCATCTAAGGAATATCCTCATATCTATTCAATTTCTGCTTCAGCA
TATGAAAGTGTTTTCAAGAGTAACATCAATTAAGCTATAGTGATCAGTGGTGAATCAGGA
GCAGGTAAAACAGAAAATGCTAAATATGCTATGAGATATCTTACATAGCTTTCAACGAAA
AAAAATAATTAAGAAGAAGTATTTTAAAGTAGGAAAATTTCAGATCCTAATCGTATTAGA
GCAAGTAGTGTTTCCACAAAAACGATTGAGCAGTAAATTTTATTTTGCAATCCAATTATG
GAGGCATTTGGAAATGCAAAAACAGCCAGAAATAACAACTCTTCAAGATTTGGTAAGTAT
GTTTCGATCCTTGTTGAGTGCACTACTTAAAAAATCTTAGGTGCATAAATATAAAAATAT
TTGCTTGAAAAAAGCAGAGTTACTCATATTGCAAATTAAGAAAGAAATTATCACATATTT
TATCATCTACTTTCTAACAAGAAGATCGTAGAAGATCTCCAAATTTCAAGCAACCCTTCT
GATTATAATTTCTTAAATTAAAGTGGAATATACACCGCTGATTAAATTAATGATTCTAAG
CTTTTTTAAGAAGTTTAGAACAGCTTCTAGAGTATGGGATTTTTACCAGATAAAATATTA
ACTATATGGTAAATACTTGCCTCCATATTGCTGCTAGGAAATATTTAGTTTACACAAGAA
GAAGAGGACAAGGTAGAGATAAAAAATAAGGATGTCTTGACTCATATTTCTAAATTACTT
CTTTGTGATGAGCAATTAATATAAAAGGCTCTTACAATAAAAATTTTGGAGACAGGTAAA
AATTAATTGGAAGTTCCATTAAAAGAAAATGAATGTGTTGCTATGAGAAATTCTTTAAGC
AAAATCTTGTATGATAGATTATTCACATGGCTTGTTTAATAATTAAATTCTGCAATTAAT
CCACCTGCTTTAAAATAAGTTAAATCTCTTTCTATTGGCTTATTGGATATATTTGGTTTT
GAGAATTTTTAGATTAACAGCTTTGAATAGCTATGCATCAATTATACAAATGAAAGACTG
TAGAAATTATATATATCTTATGTTTTCATATAAGAAGAGAAAATTCTGAGGGAGGACGGA
TTAGGGTAGTATTTAAATAATTTAAGCTACTAGGATAATCAACCAGTAGTAGATTTAATT
GATTCTAAAGAAGGTATTTTAGAGTTGCTTAATGATTAATGTAAAAATAAAGGAGGAACT
GACAAGAAGTTTTTAGAATCACTTAAATCACTTTCAAATAAATTTGAGAAAATATAATTC
CCAAAGATTCAAAAATCCACATTTATTATAAAACATACAGCAACTGATGTTGAATATTCA
TCAGAAGATTTTTGTGATAAAAATAAAGATGAGGTTAGTAAACAAATCGAAAGTTGCATT
AGACAGAGTAAAAATTAGATTGTTGTATCTATATTTTCAATAGAAGGAAATGAAACCACA
AATTAAATGTAGAAGGATAAATTTTTAGGTGAAAAATTTAGAAATTAAATGAATGACTTG
ATGAATGTTTTAAATTCATGCTAAGTTCACTTTGTGAGATGCATTAAGCCAAATGAGACA
AAAGAGATGGATAACTTCGTTGAATAGTATGTTGCTTAGCAAATATAATATCTAGGTGTT
TTGGAATCAATTGAAGTTAGAAAGCAAATGTATCCCTTTAGAAAAACATACTCTTAATTT
TATGAGCTATTTTATCTAATTGATGAATAACTTAGAAAATCTGGTAAACCCAAAAATATT
TCGTAGTCTTTCAATTTCAGACAAAGCGTAGAGCAGCTAATTCAAAGAAATTTTCCTCAT
TTTAATTAGAAAGTTTGTTTGTACGGTAATACTAAGATTTATTTAAAGGCAGAAAGTGAA
AGAGAGTTAGATTTTAAAAAATAGTAAATTTTAAAATAATTGCATGATCAAGCTGTGTTA
TAAATTTAAACAACATCAACAAAATTTTTCTAAGTTAAAAAATGCAGTTTGCTTAATTCT
TTGAAATCATTTTCAATAGATTTTAGATTAAAATTTAGACTAAGGAATATCCTTATTATG
GGAGATATAAAAATATCTAACACTATCAAAAAAGCTTTTATGACTTGGAAGTGTATAAAA
GATAAACTAAAAGAATAAGAAATAGAGAACTAGAAAAAATAAAAGTAAAAATAGTAAGAA
GAAGAGCTAAAGAGGAAGAAAAAATAGATAGAAGATGAAGAAGAGAGAAAAAATTAATCT
TTAAAGAATGACGAATATTATGAAGAATATGAAAAAAATATGGCAAATTACATTGCCTCA
GATTCAAAATCAAACATGCACTTGATAAATTAATAGGAGACTGAAGAAGAAACACAAACC
AATTTAGGTGACACCAAACGAAATTTGATATATTAGCTAAATGAATGTAATTACAATGAT
AACTTGTATAATAACATGAGATAAAATAACTAAGACTCATACTATAGTAATTCAATGCTT
GATTAATCGTCAAACTATTAAAGTGTCATAGATCAAAGTTATGCAAGCATAACTGGAATA
AAACTACATGAACAAGAAGATTAAAAAAGAGTAAATGAACTCATTCAAAAAGAAGGAGGA
TACGATAAGCAGTCAGACAACCTTATTTCTTAATACACAAGTATTGCTAAATATTACACT
GGAAAAAAAGAATTAACAGTTTCTCCTCCTATAGATGAAGAATGCTAGAGCCCACCTTTA
ATCTTGCAGATACTTGAAAAGCAGCACTCCTATTAAGAGCCCGCCTAATAAGATTAAATT
AATGATATACTTTATTTGTAATTCATAGAAAAAGATGTTTCTAGATCGATATTGGATGAT
TTTAAAAGATTTGAATTAGATGAATATTTGAAACAAGTTTTGAAGAAGAGATCAAAAAAT
ATATTCTAAACAAAGAAAGTAGAGGAAATTATGGTAGTGTCTCATAAATAACTTTCAAGT
AGCTTAACAAAGCTAACAAAAGAGGAGGACAAAAAGGCAGTGGAAGTTTTTAAAGATATT
CTCAAATTAATGCAAAAGAAAGACTAAAAAGATAATGAATAGATAGACATAATAATATAT
TCAATATTAAATAATTGCATGAATACAAGTCTTAACTTCAAAGATGAAATTATGTTATAG
ATGCTTAAATAAATAAACAATAATAAATCCAAAACAGAAATTATCAGAGTTCTATAGTTA
ATGACAGCTTTCACTTACATGTTTAAAGCAAGTTTAAATACAATTCACTGTGCTCTCTAA
TTTCTATATACAATATTTAATTCCTTAAAATAAAAATAAATTGATGAGTTCCAGTCTAAA
TAATTCCAATACTTAATCAACAAGCTTATTAAAGATAGAAAGAGAAAATAATCTGAAAAA
AAATACCTTTTAACAAGTTACTAGATTCGTTACTTGATAAACTTAAAATAAATTATCTTT
CCTCTGATTCTCCCAAATGGCTCACAGTACTGTATAAACATAGATCCCACATTTTAGATA
AGCGATTTAAAACAGAGAGCTTTGGATTTGATGGAAATACCTAAAAGAATAAATTAAGAA
CTGTTCGGTATTTACAAGATTTCAGATTTAGCTGATTCATACGAAGAAAAACTATTCTCA
GATACAGAATATGTATGGGATTTGATCTCAGAGCTAGAATGCAAAAAGCTAGCATATTAA
AACTAAAATAAGGTATTTGACTCTTTTTTCCTACTTAAGGTAAAATATGGATACAAGTTT
AGCCCATCAGATGCTGTGTCAATTTCTTACTTCTACTAACAATCTAAGATTGACATCATT
TCAAAAAAAATACTTTTAACAAGAGAAGATAATCTAAAGATATCTTGTCTGAATATTTAT
ATAAATTATGAACCTTTAGTCGAAAATAATATAGATGATATCTATCAAAATTCTGAAAGT
TTAAGTTAAGAAGAAAAGGAAAAAACAGCTTAAGAAATAACAACTTTATTCCAGCAATTG
CAACCTTACTTAAGAAACTAATTATAAGCTAAATTAGAATATATATCTGTTCTTTCTAAA
TATGACGAATACATGGGGTGGATTTTACGTAATGTCACAGTAAAATTAGACTAAAAGTCT
TTTGCTGCTTCTATCAATATAAATCCTTTCATAATTGTTTTAAATCCTAACGAAAATAAA
AAAGAGAATAAAATAAAAATTCCCACTGACTGTATTTCTAATTAATTTATTGAAAATGAA
AGTTATTTGATTTTGAAATTGAAATAATCACAGAAAAAAAATTAATAACCCTTACCTAAT
ATGGTTATACTTGAGACTCCATTTGCTTAATAAATATTTTCTTATTTTAGTTAATATATA
GAGTTAATTAAAGAATAATATAATGAAACTGATGGTTATCTTGTTAATAACTGTGACGAT
AATCTTAATGGTGATGCTTATGAATCTTAAAATGAATCAAGTCCTTAATAAGAAGAATTT
GCAACTTAGTACTACTGA


>TTHERM_00327320(protein)
MDIENQISDDSKTYDDMVEMAVLNQSEILKNVSTRYKQDKIFTLIGPTLIVMNPYKQISN
LFDDQVMQMISEQAKQKQEMINLQQSSKEYPHIYSISASAYESVFKSNINQAIVISGESG
AGKTENAKYAMRYLTQLSTKKNNQEEVFQSRKISDPNRIRASSVSTKTIEQQILFCNPIM
EAFGNAKTARNNNSSRFGKYVSILVECTTQKILGAQIQKYLLEKSRVTHIANQERNYHIF
YHLLSNKKIVEDLQISSNPSDYNFLNQSGIYTADQINDSKLFQEVQNSFQSMGFLPDKIL
TIWQILASILLLGNIQFTQEEEDKVEIKNKDVLTHISKLLLCDEQLIQKALTIKILETGK
NQLEVPLKENECVAMRNSLSKILYDRLFTWLVQQLNSAINPPALKQVKSLSIGLLDIFGF
ENFQINSFEQLCINYTNERLQKLYISYVFIQEEKILREDGLGQYLNNLSYQDNQPVVDLI
DSKEGILELLNDQCKNKGGTDKKFLESLKSLSNKFEKIQFPKIQKSTFIIKHTATDVEYS
SEDFCDKNKDEVSKQIESCIRQSKNQIVVSIFSIEGNETTNQMQKDKFLGEKFRNQMNDL
MNVLNSCQVHFVRCIKPNETKEMDNFVEQYVAQQIQYLGVLESIEVRKQMYPFRKTYSQF
YELFYLIDEQLRKSGKPKNISQSFNFRQSVEQLIQRNFPHFNQKVCLYGNTKIYLKAESE
RELDFKKQQILKQLHDQAVLQIQTTSTKFFQVKKCSLLNSLKSFSIDFRLKFRLRNILIM
GDIKISNTIKKAFMTWKCIKDKLKEQEIENQKKQKQKQQEEELKRKKKQIEDEEERKNQS
LKNDEYYEEYEKNMANYIASDSKSNMHLINQQETEEETQTNLGDTKRNLIYQLNECNYND
NLYNNMRQNNQDSYYSNSMLDQSSNYQSVIDQSYASITGIKLHEQEDQKRVNELIQKEGG
YDKQSDNLISQYTSIAKYYTGKKELTVSPPIDEECQSPPLILQILEKQHSYQEPAQQDQI
NDILYLQFIEKDVSRSILDDFKRFELDEYLKQVLKKRSKNIFQTKKVEEIMVVSHKQLSS
SLTKLTKEEDKKAVEVFKDILKLMQKKDQKDNEQIDIIIYSILNNCMNTSLNFKDEIMLQ
MLKQINNNKSKTEIIRVLQLMTAFTYMFKASLNTIHCALQFLYTIFNSLKQKQIDEFQSK
QFQYLINKLIKDRKRKQSEKKYLLTSYQIRYLINLKQIIFPLILPNGSQYCINIDPTFQI
SDLKQRALDLMEIPKRINQELFGIYKISDLADSYEEKLFSDTEYVWDLISELECKKLAYQ
NQNKVFDSFFLLKVKYGYKFSPSDAVSISYFYQQSKIDIISKKILLTREDNLKISCLNIY
INYEPLVENNIDDIYQNSESLSQEEKEKTAQEITTLFQQLQPYLRNQLQAKLEYISVLSK
YDEYMGWILRNVTVKLDQKSFAASININPFIIVLNPNENKKENKIKIPTDCISNQFIENE
SYLILKLKQSQKKNQQPLPNMVILETPFAQQIFSYFSQYIELIKEQYNETDGYLVNNCDD
NLNGDAYESQNESSPQQEEFATQYY


>TTHERM_00327320(gene)
ATGGATATCGAAAATTAAATAAGCGATGATTCAAAAACATATGATGACATGGTTGAGATG
GCCGTGTTAAATTAATCTGAAATTCTAAAAAATGTATCAACTCGTTACAAGCAAGATAAA
ATATTTACATTGATAGGACCTACTTTAATTGTGATGAATCCATATAAATAAATAAGCAAT
TTATTTGATGATTAAGTAATGCAGATGATATCTGAATAGGCTAAATAAAAACAGGAAATG
ATCAATTTATAGTAATCATCTAAGGAATATCCTCATATCTATTCAATTTCTGCTTCAGCA
TATGAAAGTGTTTTCAAGAGTAACATCAATTAAGCTATAGTGATCAGTGGTGAATCAGGA
GCAGGTAAAACAGAAAATGCTAAATATGCTATGAGATATCTTACATAGCTTTCAACGAAA
AAAAATAATTAAGAAGAAGTATTTTAAAGTAGGAAAATTTCAGATCCTAATCGTATTAGA
GCAAGTAGTGTTTCCACAAAAACGATTGAGCAGTAAATTTTATTTTGCAATCCAATTATG
GAGGCATTTGGAAATGCAAAAACAGCCAGAAATAACAACTCTTCAAGATTTGGTAAGTAT
GTTTCGATCCTTGTTGAGTGCACTACTTAAAAAATCTTAGGTGCATAAATATAAAAATAT
TTGCTTGAAAAAAGCAGAGTTACTCATATTGCAAATTAAGAAAGAAATTATCACATATTT
TATCATCTACTTTCTAACAAGAAGATCGTAGAAGATCTCCAAATTTCAAGCAACCCTTCT
GATTATAATTTCTTAAATTAAAGTGGAATATACACCGCTGATTAAATTAATGATTCTAAG
CTTTTTTAAGAAGTTTAGAACAGCTTCTAGAGTATGGGATTTTTACCAGATAAAATATTA
ACTATATGGTAAATACTTGCCTCCATATTGCTGCTAGGTAATTCTTTCTTATTGTAATAT
TTAATTATCCGTTGAAATCGATTAATCAAAATTGTTAAAATTTTACGACTAGATCTCAAT
TTGAAATTAATAATCTTTCCTAATTAAAGATTATTCTAAATGCATTCTAAAAAGAGATTG
AGAATAAATACTTTAATTGATAAACAAATAATTCATTTTTCTTTGATAATCTTGACTCTT
AAATATGTTTTCAGTTGTTCACAAAGCTAATTTTGATCATTTTTGAGCTCAAATTTTTTC
AAGCAAGAATAAATATTTTATAAATTTAATGATAAAATATTTGATTCAAATAATGAAAAC
AAATTTCAGTAAATAAAAACATAAAAAAAACTTGAATAAAAAATGAAATATAAAATTTAT
TAAAATTTGTTAAAAACAACAATATCTCATTTGCAATAATTTAATTAAAGATTAAAACAA
TATTTTAGAAATTCTAAATCAAGTAACTAAAAAAAACCATAAATATCCAATTTGAAATAT
TAATTTTTCAAACTGAGATATTTATTAAATTCAATCACACAAAACATTTAAATGAAAAAA
TATAACAAAAAAAGATAGTTTTTGGGCATAAATTAAATTAAAAAATCTTTTTGTAGATTT
TCGTAGTTTAATTTGTTGATATATATAAAAAATAGGAAATATTTAGTTTACACAAGAAGA
AGAGGACAAGGTAGAGATAAAAAATAAGGATGTCTTGACTCATATTTCTAAATTACTTCT
TTGTGATGAGCAATTAATATAAAAGGCTCTTACAATAAAAATTTTGGAGACAGGTAAAAA
TTAATTGGAAGTTCCATTAAAAGAAAATGAATGTGTTGCTATGAGAAATTCTTTAAGCAA
AATCTTGTATGATAGATTATTCACATGGCTTGTTTAATAATTAAATTCTGCAATTAATCC
ACCTGCTTTAAAATAAGTTAAATCTCTTTCTATTGGTAAAATAGTTAATATGCATCTATT
AAATTGAATTAGCTTATCTTTTATTAATCTAGGCTTATTGGATATATTTGGTTTTGAGAA
TTTTTAGATTAACAGCTTTGAATAGCTATGCATCAATTATACAAATGAAAGACTGTAGAA
ATTATATATATCTTATGTTTTCATATAAGAAGAGAAAATTCTGAGGGAGGACGGATTAGG
GTAGTATTTAAATAATTTAAGCTACTAGGATAATCAACCAGTAGTAGATTTAATTGATTC
TAAAGAAGGTATTTTAGAGTTGCTTAATGATTAATGTAAAAATAAAGGAGGAACTGACAA
GAAGTTTTTAGAATCACTTAAATCACTTTCAAATAAATTTGAGAAAATATAATTCCCAAA
GATTCAAAAATCCACATTTATTATAAAACATACAGCAACTGATGTAAATTAATCTAAAAA
ATAATTAAAACAGTAAAAATTATTGTTTCAAATAATTAGGTTGAATATTCATCAGAAGAT
TTTTGTGATAAAAATAAAGATGAGGTTAGTAAACAAATCGAAAGTTGCATTAGACAGAGT
AAAAATTAGATTGTTGTATCTATATTTTCAATAGAAGGAAATGAAACCACAAATTAAATG
TAGAAGGATAAATTTTTAGGTGAAAAATTTAGAAATTAAATGAATGACTTGATGAATGTT
TTAAATTCATGCTAAGTTCACTTTGTGAGATGCATTAAGGTAATAACTAAGTATATTTCA
ATTAAATTTTAATAAAAAATTATTTATAACACAGCCAAATGAGACAAAAGAGATGGATAA
CTTCGTTGAATAGTATGTTGCTTAGCAAATATAATATCTAGGTGTTTTGGAATCAATTGA
AGTTAGAAAGCAAATGTATCCCTTTAGAAAAACATACTCTTAATTTTATGAGCTATTTTA
TCTAATTGATGAATAACTTAGAAAATCTGGTAAACCCAAAAATATTTCGTAGTCTTTCAA
TTTCAGACAAAGCGTAGAGCAGCTAATTCAAAGAAATTTTCCTCATTTTAATTAGAAAGT
TTGTTTGTACGGTAATACTAAGATTTATTTAAAGGCAGAAAGTGAAAGAGAGTTAGATTT
TAAAAAATAGTAAATTTTAAAATAATTGCATGATCAAGCTGTGTTATAAATTTAAACAAC
ATCAACAAAATTTTTCTAAGTTAAAAAATGCAGTTTGCTTAATTCTTTGAAATCATTTTC
AATAGATTTTAGATTAAAATTTAGACTAAGGAATATCCTTATTATGGGAGATATAAAAAT
ATCTAACACTATCAAAAAAGCTTTTATGACTTGGAAGTGTATAAAAGATAAACTAAAAGA
ATAAGAAATAGAGAACTAGAAAAAATAAAAGTAAAAATAGTAAGAAGAAGAGCTAAAGAG
GAAGAAAAAATAGATAGAAGATGAAGAAGAGAGAAAAAATTAATCTTTAAAGAATGACGA
ATATTATGAAGAATATGAAAAAAATATGGCAAATTACATTGCCTCAGATTCAAAATCAAA
CATGCACTTGATAAATTAATAGGAGACTGAAGAAGAAACACAAACCAATTTAGGTGACAC
CAAACGAAATTTGATATATTAGCTAAATGAATGTAATTACAATGATAACTTGTATAATAA
CATGAGATAAAATAACTAAGACTCATACTATAGTAATTCAATGCTTGATTAATCGTCAAA
CTATTAAAGTGTCATAGATCAAAGTTATGCAAGCATAACTGGAATAAAACTACATGAACA
AGAAGATTAAAAAAGAGTAAATGAACTCATTCAAAAAGAAGGAGGATACGATAAGCAGTC
AGACAACCTTATTTCTTAATACACAAGTATTGCTAAATATTACACTGGAAAAAAAGAATT
AACAGTTTCTCCTCCTATAGATGAAGAATGCTAGAGCCCAGTAAATTTTACTTTAATATT
AAATTAAAAATTTAAATCAATTTATTTTATATTGGGTTAAATTATAGTGTCATTCTTAAA
ATTTATTTTCTTTTTAATTGAGTTTTAGAGAAATAAATTTTTATAAATTAAAATTTTATT
TGAATAACTTATTTAAATCGAGTAATTCATTTATTTAAAATTAATATATGTAAAATAAAT
AATTAGCCTTTAATCTTGCAGATACTTGAAAAGCAGCACTCCTATTAAGAGCCCGCCTAA
TAAGATTAAATTAATGATATACTTTATTTGTAATTCATAGAAAAAGATGTTTCTAGATCG
ATATTGGATGATTTTAAAAGATTTGAATTAGATGAATATTTGAAACAAGTTTTGAAGAAG
AGATCAAAAAATATATTCTAAACAAAGAAAGTAGAGGAAATTATGGTAGTGTCTCATAAA
TAACTTTCAAGTAGCTTAACAAAGCTAACAAAAGAGGAGGACAAAAAGGCAGTGGAAGTT
TTTAAAGATATTCTCAAATTAATGCAAAAGAAAGACTAAAAAGATAATGAATAGATAGAC
ATAATAATATATTCAATATTAAATAATTGCATGAATACAAGTCTTAACTTCAAAGATGAA
ATTATGTTATAGATGCTTAAATAAATAAACAATAATAAATCCAAAACAGAAATTATCAGA
GTTCTATAGTTAATGACAGCTTTCACTTACATGTTTAAAGCAAGTTTAAATACAATTCAC
TGTGCTCTCTAATTTCTATATACAATATTTAATTCCTTAAAATAAAAATAAATTGATGAG
TTCCAGTCTAAATAATTCCAATACTTAATCAACAAGCTTATTAAAGATAGAAAGAGAAAA
TAATCTGAAAAAAAATACCTTTTAACAAGTTACTAGATTCGTTACTTGATAAACTTAAAA
TAAATTATCTTTCCTCTGATTCTCCCAAATGGCTCACAGTACTGTATAAACATAGATCCC
ACATTTTAGATAAGCGATTTAAAACAGAGAGCTTTGGATTTGATGGAAATACCTAAAAGA
ATAAATTAAGAACTGTTCGGTATTTACAAGGTATTAGTTATTAATATATTTCTCAAAATA
TTAATTTAAGTTTTTATAAAAGATTTCAGATTTAGCTGATTCATACGAAGAAAAACTATT
CTCAGATACAGAATATGTATGGGATTTGATCTCAGAGCTAGAATGCAAAAAGCTAGCATA
TTAAAACTAAAATAAGGTATTTGACTCTTTTTTCCTACTTAAGGTAAAATATGGATACAA
GTTTAGCCCATCAGATGCTGTGTCAATTTCTTACTTCTACTAACAATCTAAGATTGACAT
CATTTCAAAAAAAATACTTTTAACAAGAGAAGATAATCTAAAGATATCTTGTCTGAATAT
TTATATAAATTATGAACCTTTAGTCGAAAATAATATAGATGATATCTATCAAAATTCTGA
AAGTTTAAGTTAAGAAGAAAAGGAAAAAACAGCTTAAGAAATAACAACTTTATTCCAGCA
ATTGCAACCTTACTTAAGAAACTAATTATAAGCTAAATTAGAATATATATCTGTTCTTTC
TAAATATGACGAATACATGGGGTGGATTTTACGTAATGTCACAGTAAAATTAGACTAAAA
GTCTTTTGCTGCTTCTATCAATATAAATCCTTTCATAATTGTTTTAAATCCTAACGAAAA
TAAAAAAGAGAATAAAATAAAAATTCCCACTGACTGTATTTCTAATTAATTTATTGAAAA
TGAAAGGTAATTTTAAAATTTATATTTTCTTTTTGAAACATTTTTTCATTTTAAAAAAAT
TATTCAAATATTTTATTTAAGGCTTAATTTATCTTGCTATTAAAATTAATTTTCTAAAAT
AAATTTTTGTATTTTTTTAATAAAAAATAGTTATTTGATTTTGAAATTGAAATAATCACA
GAAAAAAAATTAATAACCCTTACCTAATATGGTTATACTTGAGACTCCATTTGCTTAATA
AATATTTTCTTATTTTAGTTAATATATAGAGTTAATTAAAGAATAATATAATGAAACTGA
TGGTTATCTTGTTAATAACTGTGACGATAATCTTAATGGTGATGCTTATGAATCTTAAAA
TGAATCAAGTCCTTAATAAGAAGAATTTGCAACTTAGTACTACTGA