Identifiers and Description

Gene Model Identifier

TTHERM_00074290

Standard Name

MYO7 (myosin)

Aliases

PreTt09972 | 5.m00323 | 3828.m01236

Description

Myosin heavy chain; member of proposed myosin Class XX, distinct from previously defined myosin classes; contains predicted coiled-coil and FERM domains

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00074290

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_07165.19.997093137033517e-262myosin (1795 aa)
OxytrichaContig18292.0.g1081.9991914687114462e-138Myosin head (motor domain)
WormBaseWBGene000020386.997490125514264e-124locus:hum-5 status:Confirmed
UniProt:G5ECZ0 protein_id
:CAA84673.1
DictyBaseDDB_G02891176.99920276797163e-121myoB on chromosome: 5 position
2410248 to 2413925
SGDYOR326W3.999284652801983e-113MYO2 One of two type V myosin
motors (along with MYO4) invol
ved in actin-based transport o
f cargos; required for the pol
arized delivery of secretory v
esicles, the vacuole, late Gol
gi elements, peroxisomes, and
the mitotic spindle

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16505385: Foth BJ, Goedecke MC, Soldati D (2006) New insights into myosin evolution and classification. Proceedings of the National Academy of Sciences of the United States of America 103(10):3681-6
  2. Ref:15988740: Williams SA, Gavin RH (2005) Myosin genes in Tetrahymena. Cell motility and the cytoskeleton 61(4):237-43

Sequences

>TTHERM_00074290(coding)
ATGTTAGCTAATTAGGTTAACACTAGTTGGATGCTTCCTGACGAATAATGTTGGGTAGAA
TAGGACTCTAAAAGTGATAGCGATGTTTTGTTTAAGAAAGCCATTATCAAAAGTTTAGAT
AATAATAAATAAAGTGCGAATATTGTAATTATAGATGAGCAAGGAAAGCCACAAGGATCA
GAGATCAAGGTGAGCGTCTCTTTGCTTTAAGAGTGTAATAAAGAATCCAGGCCCCAAGGA
TGGGATGATATGGTTTAGATGAATACTCTAAACGATGCGGAAATATTGATTAATGTGAAA
AAGAGATTCTCACAAGATTTAATATTTTCATACATTGGTCCCACTCTTATAGTCATGAAT
CCTTATAAAATTATTTAGTAAAGCTTTAATCCTCAAGTTATGAACATGTTTTAGAGAGCT
GTTTAAAAAGGCGAAGCATTTTAGTAGTCAGAATATCCTCCTCATGTTTATGCACTCTCA
GCAAATGCTTATATTCAGCTATTTTCAAATAATAAAAAATAAGCAATTGTAATTTCAGGC
GAATCAGGTGCAGGAAAGACAGAAAATGCAAAATATTCTATGAAATATATAACTTCATTG
AGTGATGCTGCTCATTCTCATAGCGAGCACAATGGTTATACAACAAATAAAAAGTAATAA
GGAGCTAAACAAGCACCAATTGAAGAGAAGATTCTAGGATGTAATCCTATTTTGGAATCA
TTTGGTAATGCGAAGACAGTCAGAAATAATAACTCAAGTAGATTTGGTAAATATGTCAGA
ATTTGGATAGAGAAAAAGAAAAGACTAATTTAAGGAGCTGAGATTTCTAATTATTTGCTT
GAAAAATCTCGTGTTACTATGGTTGCTGAAGGCGAAAGAAATTATCATATTTTTTATTCA
TTTCTTGCGGGTGTGAATCAATAGATACTTGAAGAGTTCAAAATATTAAGAGATCCAAAA
CAGTTTAATTACCTCAACTAAAGTTCATCCTTCCAAGCTGAAGGCATAGATGATGTTGAG
AATTTTAACGAAGTGTAACAATCATTCTAAAAGTTAAATTTTACATCCTAAGAAGAAAAG
TCAATTTATTCAATTCTTGCAGGTATTTTGCAATTGGGAAATATTAGTTTTGATGATAAG
ACCTATTCTGAAGGAGAAAAACCTTGTTCTCTTATAAATTAAGAAGCCTTAGAAAAAGCT
GCGTTTGTTTTGAAGGTAGACAAAGAAGAACTTAAAAACTGTTTAGTTTATAAAAGAAGA
GTCCTGCCTGGGGGAAAGCCTATTGACTCTCCAATAAGCAAATAAGAATGCAACATTACA
AGAGATTCTTTGGCTAGAGCTCTTTATGATAAGCTTTTTAATTGGCTGGTTAGCAAGCTA
AATTAAAATATTATGCCTAATAGCAGTGTAAATATTGCTGATTGTTTGAGTTTGGGATTA
TTGGATATTTTTGGATTTGAAAATTTTAAAGTGAACTCTTTCGAATAACTTTGCATTAAT
TACACAAATGAAAAGCTGCAGCAATTATATATTGTTTATGTTTTCAAGTCTGAAGAGCTA
GAATTTAAAGCAGAGGGATTAAATGATTATATGAATTAAATACAATTCAAGGATAATTAA
GGAATTATTGATTTGATTTCTTTGCCTAAGAAGAGTATCTACGATTTACTTGATGATGAA
AGTACAATCAATACAGGATCTGACGAATCATTGCTTAAAAAGATTCTTAAAGAACATGCT
TAAAACTAATATCTTGTTAACGTAAAACCCCATCTCATAAAAGATACTTTTTCTATTAGA
CATACAGCAAAAGATGTCGAATACAACATTAATGGATTTAGAGTAAAAAACAAAGACGAA
ATTAGTGATTCAATTAATGATGCCTTAAGCAAAACTTAAATTAATGAAATTAAAACCATT
TGGACTTTTGATGACTTACAAAATTCTTAATAGGTCGATTAAATTTTGAATCAAAAAATT
TAAGTTAAGTCTAAGTCTAATAAATTTTTAGGAGCAAAGTTCCGTAATTAAATTAAAGAA
TTGATGGATGAACTTCAGTGCTGCGATGTCCATTTTATTCGTTGCATAAAACCAAATGAA
TTAAAATAAAAAGAATTGTTTGATTAAAATTTCGTTATGCTTTAAATTAGGTATTTAGGT
ATTTTAGAATCTGTAAGAGTTCGTAAAGAAGGTTTCCCTTCGCGTTTTGATTATGATATA
TTCTACAAAAGATATTACGAACTATGCTAATCATTTAAACATACAAATCCAAACAAATTT
AATTAATTAGCTATTTAAAATAAGTAAGATTTATGCACTTAATTAATTCAAACATTAATT
AAGGATTTAAAATTGGTATTAAACAAAAATGTGTTATTTGGTAAAACTAAAATTTACATG
AAATTAGCTGTTTCGAACCATTTAGACTTTTTGTTACTTGAATTTTATAAGGCTTAAGAA
GAAAAAGCTAATAAAATAAAAAAGTTTTTAAAATTATGTATTTATAAAAAAAATGTATTT
TTAAAGATCAAATGGCTTAAAGAGTAGAGAGCTAAATTAAATATTTTAGTAAAGAAATTC
AAAGAAAAGCAATTAGCTAAGTAGTAAAAAAAGCTATAAGCTTTAGAAAGTTTTAATTTA
TTATATGTAATGAGACTCTACTATGCATTTAATATATTGAAAGAAGCTTCATTGTAGGAT
AAAAAATTGTAATTTTTCAAAGTTTTAGATACAGCTTTTAAGCGTACAGCTTAGTAGAAC
TATTAGCATGTCTTTACTTTACTTAAGTTAAAGTTTTCACCTCAGCAAAAAGCAAATATA
ATTGGAAATCAAATTTAACAAATAGATAACTTAATTACCGATGAGGAGTAATAAAAAAAG
TAAACAGAAAATTAAAATATTTTATAAAAATAGAATGGTTCATCTAATGAGCCAAGTAAT
TAATCTTCTTCTCTAATAAATTCCAATCAAACTAATGAAAACAGTAACAGAAATACTGAA
AATCAGCAAGATTATTTTCATAATATTTTAAATGAAAATGAAAGTGAGTAGCCATAGGAA
AGAAATATTAGAGATGAATTCTCAACTAATGGCTTGGAAGTATGGCCATTAATGACTTAG
CTAGAAGATAAAAATGAGAGATAACTTATTGAGGAGAACAAAAGTGATAATCTAATGTCA
TTTTTTAGAAATGGATATGTATCTTAATATAGTACTCTCAATCCTAAGTAGTCTCACATA
GATTTAGAAAAGCCATCACAACTTCCAATAGATCCTGATTATGAAATATAATTCGATGAT
ATTGATGGTGCACTTATGAGAAAAGTAGAGGATAATGACTTTTTCTCATTTTGTGAGAGT
TATATAGTAAAATCAAAAAAGAACTTCGGAAAGAAAATGCCTCCAATAAAATAAATTATG
AGCTACTCCAGCAGCAATCTCGTTGATCCTCTTACTCAAAGCCCTACAATATAGAATCAT
TCTTAACTAATTTTTAGATCTCTTCTAAAATTAGCCAAAAATAGGAGATCACGTTTCCCA
CCAAATACTCATATTGAAAACATTATATTGATGTGTTATGGAACTCCTGAAAAAATGAAC
GAATCTATTTTTTCCTCTGTAAAAGATGAAAATTCTAAGATTATGGAAAACTATGCATCA
AAAATGTAAACTAATTCCATCTAACGAGAATAGAAACCCAATGATAGCTTAAACCAGAGC
CATCAGTCGATGGGATCTACTATAAATTAAAGTGCAATTTAGGGAAATAATGATGATGAC
GATGAACCAAATATTAAAGAAATTCTTGGTAATAAAATAATGTAAATAGTCAATAATAGC
CATCAGCCAATCAGAGACGAGACCTTCATGTAAGTTTGCAAGCAAATTCATAACTAGCCA
ATATTAGACAGTCAAAGGATCCTCCTGTAATTCTTTACTGAATTGATAGGGCTTTTCCCT
CCAAGCGATTACCTATTAATCCCTTTAATGAGCTTCTTCAAATACATAGCTACTCAATCT
GCTTGTACAAAAGTCTAAAAAGAATGCAAATACATTTTTGTTAAGCTAGCTAAGTTATGG
TAGAGTTTTAATATGATTAAAATGGTAGATTTTACTTAGTACAATCAATAATTTTTAGAA
GAAAATAAAATATTTAAATCAATTGATAAAGACTAGTGGACAAGTGAAGTCTTAAAAAAG
CAAATATCTTAATTTGATTTCTTCTACAATCATTTATAAAGAGTGGATTCAAGAGAACAA
ATTCCTACAGATTGGGAATTATCTATAGCAAACGAGCATAAATTGTTTAAAGTGAAAATA
TATTTACTTAATGAAACTAGTATTTCTGTTATCATCGACTCGTCTTTCTCTGTTAAGTAG
GTCAGAGATTTAGTCCTTAAAGAATTGGGATTAAAATATAGAAGTTAATATTTTGGTATT
GTTCAATCAAAGATATCAGAAGGTAAACATTACGAGCATTTCCTCAAAAACAACTAAAAG
ATGTTAGATGCACTTAACACTGTTATAAATGACACTAAATTTTTAGAAGGCTACAAAAAG
CAAGTTATTACAAAATTTTACTTAAGAATTAAAATATGTTACAAACTTTACAAACATGAC
ATAGATTCAACTATTATGTATTTTATTTAAAATGCATTTGATGTCCGCTATAATAAGTAT
TACCTGAAAGAAATAGAAGAATAAACACTAGCTGCTTACCATCTTTATATAGAGTTCGGA
CCTTATAATCCAATTTATGAAAAAGAGTGCAGAGAAAAGTTTTAAGATTTTCTCCCTAGT
AAGAGGGTTATCCCAAAATCCCCACCTGATCTTTATTAGAAAGTGCTTCTCATATACAAA
TAATTGTAGTTCGAATCTTAAAATTAAGCTAGGTGGTAATATTTGGAGCTCCTTAGAACA
AAAGATGCATTCATGTCTTACTAGTTGGAAGCTCACTAATTTTGTATCAAATAAAATGGA
GACAAATTTTAAAAAAATAAAGAGGGAAGATTAGTACACTTGGCAATCAGACCATACTAA
ATAGTTATCCTAGATGTTAACAGCTTGTCTACATTAGAAGTAATAGAACTTGAATAGATT
GAAACATGGGGTCTCAATTTATCCCAAAGAGCAAAAAACAACTAAGTATAATAGTTCTTC
TTCTTAAAAGTCAAAAATAGTGACATTCTGTATGTATTTTATATTCTATACCTCTAGGTA
GCAAACTTGCTTATTCACTCATATGCCCTCAAAAAGAGTTTTAATGAAGAGGATAGTGAA
TATAGAGATTGTTTCTTGGATATTCTCAGCATACTCTTTGATAAAGAAGAATAAGTGTAA
GCTGAGTGA


>TTHERM_00074290(protein)
MLANQVNTSWMLPDEQCWVEQDSKSDSDVLFKKAIIKSLDNNKQSANIVIIDEQGKPQGS
EIKVSVSLLQECNKESRPQGWDDMVQMNTLNDAEILINVKKRFSQDLIFSYIGPTLIVMN
PYKIIQQSFNPQVMNMFQRAVQKGEAFQQSEYPPHVYALSANAYIQLFSNNKKQAIVISG
ESGAGKTENAKYSMKYITSLSDAAHSHSEHNGYTTNKKQQGAKQAPIEEKILGCNPILES
FGNAKTVRNNNSSRFGKYVRIWIEKKKRLIQGAEISNYLLEKSRVTMVAEGERNYHIFYS
FLAGVNQQILEEFKILRDPKQFNYLNQSSSFQAEGIDDVENFNEVQQSFQKLNFTSQEEK
SIYSILAGILQLGNISFDDKTYSEGEKPCSLINQEALEKAAFVLKVDKEELKNCLVYKRR
VLPGGKPIDSPISKQECNITRDSLARALYDKLFNWLVSKLNQNIMPNSSVNIADCLSLGL
LDIFGFENFKVNSFEQLCINYTNEKLQQLYIVYVFKSEELEFKAEGLNDYMNQIQFKDNQ
GIIDLISLPKKSIYDLLDDESTINTGSDESLLKKILKEHAQNQYLVNVKPHLIKDTFSIR
HTAKDVEYNINGFRVKNKDEISDSINDALSKTQINEIKTIWTFDDLQNSQQVDQILNQKI
QVKSKSNKFLGAKFRNQIKELMDELQCCDVHFIRCIKPNELKQKELFDQNFVMLQIRYLG
ILESVRVRKEGFPSRFDYDIFYKRYYELCQSFKHTNPNKFNQLAIQNKQDLCTQLIQTLI
KDLKLVLNKNVLFGKTKIYMKLAVSNHLDFLLLEFYKAQEEKANKIKKFLKLCIYKKNVF
LKIKWLKEQRAKLNILVKKFKEKQLAKQQKKLQALESFNLLYVMRLYYAFNILKEASLQD
KKLQFFKVLDTAFKRTAQQNYQHVFTLLKLKFSPQQKANIIGNQIQQIDNLITDEEQQKK
QTENQNILQKQNGSSNEPSNQSSSLINSNQTNENSNRNTENQQDYFHNILNENESEQPQE
RNIRDEFSTNGLEVWPLMTQLEDKNERQLIEENKSDNLMSFFRNGYVSQYSTLNPKQSHI
DLEKPSQLPIDPDYEIQFDDIDGALMRKVEDNDFFSFCESYIVKSKKNFGKKMPPIKQIM
SYSSSNLVDPLTQSPTIQNHSQLIFRSLLKLAKNRRSRFPPNTHIENIILMCYGTPEKMN
ESIFSSVKDENSKIMENYASKMQTNSIQREQKPNDSLNQSHQSMGSTINQSAIQGNNDDD
DEPNIKEILGNKIMQIVNNSHQPIRDETFMQVCKQIHNQPILDSQRILLQFFTELIGLFP
PSDYLLIPLMSFFKYIATQSACTKVQKECKYIFVKLAKLWQSFNMIKMVDFTQYNQQFLE
ENKIFKSIDKDQWTSEVLKKQISQFDFFYNHLQRVDSREQIPTDWELSIANEHKLFKVKI
YLLNETSISVIIDSSFSVKQVRDLVLKELGLKYRSQYFGIVQSKISEGKHYEHFLKNNQK
MLDALNTVINDTKFLEGYKKQVITKFYLRIKICYKLYKHDIDSTIMYFIQNAFDVRYNKY
YLKEIEEQTLAAYHLYIEFGPYNPIYEKECREKFQDFLPSKRVIPKSPPDLYQKVLLIYK
QLQFESQNQARWQYLELLRTKDAFMSYQLEAHQFCIKQNGDKFQKNKEGRLVHLAIRPYQ
IVILDVNSLSTLEVIELEQIETWGLNLSQRAKNNQVQQFFFLKVKNSDILYVFYILYLQV
ANLLIHSYALKKSFNEEDSEYRDCFLDILSILFDKEEQVQAE


>TTHERM_00074290(gene)
ATGTTAGCTAATTAGGTTAACACTAGTTGGATGCTTCCTGACGAATAATGTTGGGTAGAA
TAGGACTCTAAAAGTGATAGCGATGTTTTGTTTAAGAAAGCCATTATCAAAAGTTTAGAT
AATAATAAATAAAGTGCGAATATTGTAATTATAGATGAGCAAGGAAAGCCACAAGGATCA
GAGATCAAGGTGAGCGTCTCTTTGCTTTAAGAGTGTAATAAAGAATCCAGGCCCCAAGGA
TGGGATGATATGGTTTAGATGAATACTCTAAACGATGCGGAAATATTGATTAATGTGAAA
AAGAGATTCTCACAAGATTTAATATTTTCATACATTGGTCCCACTCTTATAGTCATGAAT
CCTTATAAAATTATTTAGTAAAGCTTTAATCCTCAAGTTATGAACATGTTTTAGAGAGCT
GTTTAAAAAGGCGAAGCATTTTAGTAGTCAGAATATCCTCCTCATGTTTATGCACTCTCA
GCAAATGCTTATATTCAGCTATTTTCAAATAATAAAAAATAAGCAATTGTAATTTCAGGC
GAATCAGGTGCAGGAAAGACAGAAAATGCAAAATATTCTATGAAATATATAACTTCATTG
AGTGATGCTGCTCATTCTCATAGCGAGCACAATGGTTATACAACAAATAAAAAGTAATAA
GGAGCTAAACAAGCACCAATTGAAGAGAAGATTCTAGGATGTAATCCTATTTTGGAATCA
TTTGGTAATGCGAAGACAGTCAGAAATAATAACTCAAGTAGATTTGGTAAATATGTCAGA
ATTTGGATAGAGAAAAAGAAAAGACTAATTTAAGGAGCTGAGATTTCTAATTATTTGCTT
GAAAAATCTCGTGTTACTATGGTTGCTGAAGGCGAAAGAAATTATCATATTTTTTATTCA
TTTCTTGCGGGTGTGAATCAATAGATACTTGAAGAGTTCAAAATATTAAGAGATCCAAAA
CAGTTTAATTACCTCAACTAAAGTTCATCCTTCCAAGCTGAAGGCATAGATGATGTTGAG
AATTTTAACGAAGTGTAACAATCATTCTAAAAGTTAAATTTTACATCCTAAGAAGAAAAG
TCAATTTATTCAATTCTTGCAGGTATTTTGCAATTGGGAAATATTAGTTTTGATGATAAG
ACCTATTCTGAAGGAGAAAAACCTTGTTCTCTTATAAATTAAGAAGCCTTAGAAAAAGCT
GCGTTTGTTTTGAAGGTAGACAAAGAAGAACTTAAAAACTGTTTAGTTTATAAAAGAAGA
GTCCTGCCTGGGGGAAAGCCTGTAATTACAAACAATTAAAATTATTGTACATAAATCCTT
CTCAAAAAATAATAAAATTTGAGAAATTATATAAATTTATAATTTTATCTAAATAATTTA
TCAGCAAAAAGCACTTTTTAAGATAAATTAATTTACATAAAAAATTATTTCTAAATATTT
TACTTCAATAAAATATCTAAAAATTATTGAAATGTTTTATATTTCTAATTTAATTTTCTA
TCAAATAGATTGACTCTCCAATAAGCAAATAAGAATGCAACATTACAAGGTAATTAATTC
AATATTTATTTAATAATTTTATACTATTTTCTTATAAAAGAAATTTTTATTAAAAAGTTT
TTTATAAACAAAAACTCTTGATAATTAATTGATTTACTATTTTAAGAAAAGTCTAATTTT
TTTAATTTTTATTAGAGATTCTTTGGCTAGAGCTCTTTATGATAAGCTTTTTAATTGGCT
GGTTAGCAAGCTAAATTAAAATATTATGCCTAATAGCAGTGTAAATATTGCTGATTGTTT
GAGTTTGGGATTATTGGATATTTTTGGATTTGAAAATTTTAAAGTGAACTCTTTCGAATA
ACTTTGCATTAATTACACAAATGAAAAGCTGCAGCAATTATATATTGTTTATGTTTTCAA
GTCTGAAGAGCTAGAATTTAAAGCAGAGGGATTAAATGATTATATGAATTAAATACAATT
CAAGGATAATTAAGGAATTATTGATTTGATTTCTTTGCCTAAGAAGAGTATCTACGATTT
ACTTGATGATGAAAGTACAATCAATACAGGATCTGACGAATCATTGCTTAAAAAGATTCT
TAAAGAACATGCTTAAAACTAATATCTTGTTAACGTAAAACCCCATCTCATAAAAGATAC
TTTTTCTATTAGACATACAGCAAAAGATGTCGAATACAACATTAATGGATTTAGAGTAAA
AAACAAAGACGAAATTAGTGATTCAATTAATGATGCCTTAAGCAAAACTTAAATTAATGA
AATTAAAACCATTTGGACTTTTGATGACTTACAAAATTCTTAATAGGTCGATTAAATTTT
GAATCAAAAAATTTAAGTTAAGTCTAAGTCTAATAAATTTTTAGGAGCAAAGTTCCGTAA
TTAAATTAAAGAATTGATGGATGAACTTCAGTGCTGCGATGTCCATTTTATTCGTTGCAT
AAAACCAAATGAATTAAAATAAAAAGAATTGTTTGATTAAAATTTCGTTATGCTTTAAAT
TAGGTATTTAGGTATTTTAGAATCTGTAAGAGTTCGTAAAGAAGGTTTCCCTTCGCGTTT
TGATTATGATATATTCTACAAAAGATATTACGAACTATGCTAATCATTTAAACATACAAA
TCCAAACAAATTTAATTAATTAGCTATTTAAAATAAGTAAGATTTATGCACTTAATTAAT
TCAAACATTAATTAAGGATTTAAAATTGGTATTAAACAAAAATGTGTTATTTGGTAAAAC
TAAAATTTACATGAAATTAGCTGTTTCGAACCATTTAGACTTTTTGTTACTTGAATTTTA
TAAGGCTTAAGAAGAAAAAGCTAATAAAATAAAAAAGTTTTTAAAATTATGTATTTATAA
AAAAAATGTATTTTTAAAGATCAAATGGCTTAAAGAGTAGAGAGCTAAATTAAATATTTT
AGTAAAGAAATTCAAAGAAAAGCAATTAGCTAAGTAGTAAAAAAAGCTATAAGCTTTAGA
AAGTTTTAATTTATTATATGTAATGAGACTCTACTATGCATTTAATATATTGAAAGAAGC
TTCATTGTAGGATAAAAAATTGTAATTTTTCAAAGTTTTAGATACAGCTTTTAAGCGTAC
AGCTTAGTAGAACTATTAGCATGTCTTTACTTTACTTAAGTTAAAGTTTTCACCTCAGCA
AAAAGCAAATATAATTGGAAATCAAATTTAACAAATAGATAACTTAATTACCGATGAGGA
GTAATAAAAAAAGTAAACAGAAAATTAAAATATTTTATAAAAATAGAATGGTTCATCTAA
TGAGCCAAGTAATTAATCTTCTTCTCTAATAAATTCCAATCAAACTAATGAAAACAGTAA
CAGAAATACTGAAAATCAGCAAGATTATTTTCATAATATTTTAAATGAAAATGAAAGTGA
GTAGCCATAGGAAAGAAATATTAGAGGTAATTAATTAATCCATTAATGCATAAAATTAAA
ATAATTTATTTCTTAGATGAATTCTCAACTAATGGCTTGGAAGTATGGCCATTAATGACT
TAGCTAGAAGATAAAAATGAGAGATAACTTATTGAGGAGAACAAAAGTGATAATCTAATG
TCATTTTTTAGAAATGGATATGTATCTTAATATAGTACTCTCAATCCTAAGTAGTCTCAC
ATAGATTTAGAAAAGCCATCACAACTTCCAATAGATCCTGATTATGAAATATAATTCGAT
GATATTGATGGTGCACTTATGAGAAAAGTAGAGGATAATGACTTTTTCTCATTTTGTGAG
AGTTATATAGTAAAATCAAGTAATTAATTCATTCATTCAAATATTTTCATCAAAAAAATA
TGAAAATTAAACCAAATCTTAAAACTTATTTTAGAAAAGAACTTCGGAAAGAAAATGCCT
CCAATAAAATAAATTATGAGCTACTCCAGCAGCAATCTCGTTGATCCTCTTACTCAAAGC
CCTACAATATAGAATCATTCTTAACTAATTTTTAGATCTCTTCTAAAATTAGCCAAAAAT
AGGAGATCACGTTTCCCACCAAATACTCATATTGAAAACATTATATTGATGTGTTATGGT
AATTTCTATTTAAAATTTATTTATTTTTGATAATTATAAATATTTTTATTATTCAAAAAT
ATTTACTTGCTTATTCTTTTTAATTTATTTATTTATTACTTAAAAAAGGAACTCCTGAAA
AAATGAACGAATCTATTTTTTCCTCTGTAAAAGATGAAAATTCTAAGATTATGGAAAACT
ATGCATCAAAAATGTAAACTAATTCCATCTAACGAGAATAGAAACCCAATGATAGCTTAA
ACCAGAGCCATCAGTCGATGGGATCTACTATAAATTAAAGTGCAATTTAGGGAAATAATG
ATGATGACGATGAACCAAATATTAAAGAAATTCTTGGTAATAAAATAATGTAAATAGTCA
ATAATAGCCATCAGCCAATCAGAGACGAGACCTTCATGTAAGTTTGCAAGCAAATTCATA
ACTAGCCAATATTAGACAGTCAAAGGATCCTCCTGTAATTCTTTACTGAATTGATAGGGC
TTTTCCCTCCAAGCGATTACCTATTAATCCCTTTAATGAGCTTCTTCAAATACATAGCTA
CTCAATCTGCTTGTACAAAAGTAAATACCAATTAAGTGCAAATTTTTTTAGAGACCAAAT
CATTTCATTAATAAACCATATTTAATAAATAGTTATGGTTAGCTTTTTTCATTATAAAAA
TATTTTAATAATTTTAGGAATGTAGTTAATTAAATATTTTATTAATTATTACAGAATCAT
AAGCATTTTTTTGTTGATTTTTTATTAATAATTATTAAATTAATTAAATCAAATTTTATT
TAATACATATTATATTAATTTCCATAAATTTAACTTTTGAAATTTAATTTATAAGTAAAT
ACTAACTTTATACTATTTGTCTTTGTTTATTAATATTTTTTATTTTATTAAATAGGTCTA
AAAAGAATGCAAATACATTTTTGTTAAGCTAGCTAAGTTATGGTAGAGTTTTAATATGAT
TAAAATGGTAGATTTTACTTAGTACAATCAATAATTTTTAGAAGAAAATAAAATATTTAA
ATCAATTGATAAAGACTAGTGGACAAGTGAAGTCTTAAAAAAGCAAATATCTTAATTTGA
TTTCTTCTACAATCATTTATAAAGAGTGGATTCAAGAGAACAAATTCCTACAGATTGGGA
ATTATCTATAGCAAACGAGCATAAATTGTTTAAAGTGAAAATATATTTACTTAATGAAAC
TAGTATTTCTGTTATCATCGACTCGTCTTTCTCTGTTAAGTAGGTCAGAGATTTAGTCCT
TAAAGAATTGGGATTAAAATATAGAAGTTAATATTTTGGTATTGTTCAATCAAAGATATC
AGAAGGTAAACATTACGAGCATTTCCTCAAAAACAACTAAAAGATGTTAGATGCACTTAA
CACTGTTATAAATGACACTAAATTTTTAGAAGGCTACAAAAAGCAAGTTATTACAAAATT
TTACTTAAGAATTAAAATATGTTACAAACTTTACAAACATGACATAGATTCAACTATTAT
GTATTTTATTTAAAATGCATTTGATGTCCGCTATAATAAGTATTACCTGAAAGAAATAGA
AGAATAAACACTAGCTGCTTACCATCTTTATATAGAGTTCGGACCTTATAATCCAATTTA
TGAAAAAGAGTGCAGAGAAAAGTTTTAAGATTTTCTCCCTAGTAAGAGGGTTATCCCAAA
ATCCCCACCTGATCTTTATTAGAAAGTGCTTCTCATATACAAATAATTGTAGTTCGAATC
TTAAAATTAAGCTAGGTGGTAATATTTGGAGCTCCTTAGAACAAAAGATGCATTCATGTC
TTACTAGTTGGAAGCTCACTAATTTTGTATCAAATAAAATGGAGACAAATTTTAAAAAAA
TAAAGAGGGAAGATTAGTACACTTGGCAATCAGACCATACTAAATAGTTATCCTAGATGT
TAACAGCTTGTCTACATTAGAAGTAATAGAACTTGAATAGATTGAAACATGGGGTCTCAA
TTTATCCCAAAGAGCAAAAAACAACTAAGTATAATAGTTCTTCTTCTTAAAAGTCAAAAA
TAGTGACATTCTGTATGTATTTTATATTCTATACCTCTAGGTAGCAAACTTGCTTATTCA
CTCATATGCCCTCAAAAAGAGTTTTAATGAAGAGGATAGTGAATATAGAGATTGTTTCTT
GGATATTCTCAGCATACTCTTTGATAAAGAAGAATAAGTGTAAGCTGAGTGA