Identifiers and Description

Gene Model Identifier

TTHERM_00600770

Standard Name

MYO6 (myosin)

Aliases

PreTt22140 | 83.m00209 | 3685.m00101

Description

Myosin heavy chain; member of proposed myosin Class XX, distinct from previously defined myosin classes; contains predicted coiled-coil domain

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

  • ( PF04428 ) Choline kinase N terminus
  • ( PF00063 ) Myosin head (motor domain)
  • ( PF05316 ) Mitochondrial ribosomal protein (VAR1)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.4%

TetraMine Data

TTHERM_00600770

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_15506.19.997093137033517e-262myosin head (1638 aa)
OxytrichaContig18292.0.g1081.9992982665753866e-121Myosin head (motor domain)
DictyBaseDDB_G02886794.998015698166016e-118myoE on chromosome: 5 position
1829072 to 1832587
WormBaseWBGene000020361.9992560499818233e-109locus:hum-2 status:Confirmed
UniProt:Q17383 protein_id
:CCD68602.1
SGDYOR326W3.001222955304439e-106MYO2 One of two type V myosin
motors (along with MYO4) invol
ved in actin-based transport o
f cargos; required for the pol
arized delivery of secretory v
esicles, the vacuole, late Gol
gi elements, peroxisomes, and
the mitotic spindle
Stentor CoeruleusSteCoe_353840.0000000007582560427911907

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,
  2. Ref:16505385: Foth BJ, Goedecke MC, Soldati D (2006) New insights into myosin evolution and classification. Proceedings of the National Academy of Sciences of the United States of America 103(10):3681-6
  3. Ref:15988740: Williams SA, Gavin RH (2005) Myosin genes in Tetrahymena. Cell motility and the cytoskeleton 61(4):237-43

Sequences

>TTHERM_00600770(coding)
ATGAGCAGCTAAAATAAGCTTCCTAATTCTTCTACAAATTAATAATAGCAGGGAGGAAAT
AAAAACGCTAACAATAACCCAGTAAAAGCCAAAGAGGCAGATAGCACTTGGGTTATGAGC
AACGTTAGATGCTGGTATAAGAAAAATAATAATAGAGAAGAGCAATACATATTTAGAAAA
GCAATTATAGTATCAGATTAAGTAAAGAATGTAGGCGGACAATAAATAGTTAACATAAGC
ATTGAATAGGAAAATGGCTAAAATGCTGAATAGATTGAGACAAATGTTAAAAATTTATTT
TAGAGAGAAGAACAAAGCCAAACATCATTTTACGACATGGTAAAAATGAGTGTTCTTAAT
GAGGCAGAATTGATTGCTAACTTAAAATAGAGATATGCATAAGACAATATCTTTACTTAT
ATCGGCCCTACTTTAATAGTTTTAAATCCTTACAAAAGTTTGAAAGAATTATTTTCTAAT
CAAACGATTGATATGATAAAAGAAAATTTAAATAAAAACTTTGATTTGTTTGATCTTGAA
ATGCAATAGCCTCACATATACTCTATTTCTGCAATGGCTTATAAAAATTTAATTAAGTTC
AATAAAAAGTAGGCAATAGTTATTAGCGGTGAAAGTGGTGCAGGTAAGACAGAGAATGCA
AGATATTCGATGAGATTTTTAACTTAAATTAGTACTCATGATAACTCAAATGAAAGCATC
GAAGAAAAAATATTATCCTGCAACCCTGTACTCGAAGCATTTGGAAATGCAAAAACAGTG
AGAAATGATAACTCAAGTCGTTTTGGTAAATATGTATAAATTGAAATAGCTAAAAAGAAA
ATAAATGGAGCTACAATCACTAAATATCTACTTGAAAAAAGTAGAGTGATACATCTAAGC
TAAGGAGAGAGAAATTATCATATCTTTTATCACTTATTGGAGTCAAAAGATAATTAATTA
TTGGAAAAACTTCATCTTTTAAATAAAAAACCATCTGAGTTTTAATACTTAAGTTAGAGT
GACTGCTACTCTGTAGAAACTATTGATGACACTTAATTATTTCAAGGAATTATTAATTCC
TTCAAAGTTATGAAATTCGAAGAAGACTTGCAAAATACTATTTTTAAAATACTATCTGCT
ATTTTACATTTAGGAAACATTTAGTTTTCAAATTAATCATTTTCTGAGGGTTCATCACCA
TGCACAGTGGTAAATGAAAATGTGCTACAGATAGTCAGTAGTTTACTAGGTATTAATTTA
GATGATCTTAAGAAAGCACTTCTTTATAAAACAATTGTAGCAGTGAATGAAGTATATCAT
AAACCAGCTGATGCAGTATAGTGTCATCATGCAAAAAATACTCTGAGTAAAGCACTTTAT
GATAACTTATTCAACTGGCTAGTTGATAAATTAAACCAAATTATAAAAAATAATCAGGTA
AACTATAACACAACAAACACCTCTAATAACAATATGATTGGATTACTTGATATTTTTGGT
TTTGAAAACTTTTAAGAAAATTCTTTTGAATAGCTTTGCATTAATTATACAAATGAGAAT
CTTTAGCAACTATACATTTAATATGTTTTTAAGAATGAAGAATAAATTTTTAAAGAAGAC
GGTTTAGAGAATTTCCTTTCAAATTTATGCTATTAGGATAATTCAATGATCATTCAAACT
TTAAATAGAAGTTACAAGCTGCTTAACGATTGTTGCAAAACATAATCCAAAGACGATTCA
AAATATTTATAGTCTCTTAAAAATGACTTTAAAAATCAATAAATATAAGTCATTCAATTT
CCTAAAATGGATAATGGCACATTTTTGATAAATCACACATAGAATCCTGTTAGCTACAAA
ATTGAAGGATTTATAGCAAAGAATATCGATGAAGTAAGTTAAACCCTCAAAGATGTAATT
AGTAAAAGTAGCAACAAATACATACCTTCTATCTTTGGTAATGAAGAATAAACATAATAA
AATAGAGCAAGATTTTTAGGAGAGAAATTTAGTAATTAAATGGTAGAGTTGATGAAAGAA
TTAAATTCTTCAGATGTTCATTTTGTTAGATGTGTTAAGACAAATGAAGTTAAAAAAAGT
GACTATTTCTTGGAAGGTTATGTATTGCAATAAATAGAGTATCTGGGTGTTATAAACTCA
ATAGAAGTAAGGAAAAGCACTTATCCCTAAAGAAGGGATTATTTAACTTTTTTTAAAGAG
TATAGAGTTTGTGATGAGTAATTAGAAAAAAAAGCAATAGATTAAATTAAAAATTTTAAA
GATGAATGTAAAGCTTTAGTTTCAAAGATGTATCCAAACTACAGTGACTCTCTTATTCTA
TTTGGTAATAATAAAATCTACATGAAATAGGAATTTGAAAGTGCTATTGATTAGATAAAG
TATGCAGAAATAAAGCGTAAAAGGACTGCTTAAGTAGTAAGAATTCAGATTTATGTTAGG
TACCTTAGATTCCATAAAAGGTTTTAGAAAAAATTAGAAGGAATTAAAAAATTAAACAAT
ATTTTCTTTGCACAGAAGATTTTTAATATATATAATCATTGCTTTTAACTAATTAAGTAA
AAAGCTAAAATTACTTAAGTAAAAAATCTTATTACCTTAACGTTAAAAATAGTAAAAGCA
TCTTTTACAAAGACTACATTTTAAATTCTTAAAGAATATAGTGATAAAATGAAAGAATTA
AAAGAAAAAAATGAAGCCTAAATAGAGAATAATAAATAAATATTAGAGCAAAGTTAAGAA
GAATAAAAGGTTAGCGAATCAACATGTGTTTCAAATTAATTTTTACAAAGATAAGATACT
AGCATAAATGAAACTAATGCATCTTTGTTATATGATACTATAGCTGTTAATGAAATTTAA
ACTGAGTAATCATAAAGTAAGGTTAACACTTATAGCTTAAAAAGTGAAAAATAATAAAAT
TCTTAAAATGTGAATGCTTTTGATTTTTAGACTGGAGACTTAAGTCTATTACACATCCCA
GAGAAACATACAAATGAAATTTATGTGAATCCTCCTGACTAAGAAGAAATAGAATCAGAA
AGTCTTTTGCTTAAATTGTTGAATTCCTAAGAAATAGACGATAAAATAATTTAGTAAATG
AAGCAAGTCTAATATGCACTTGACAAGGATTATCAAATTTAACAAATAGATGAGGAAGAT
ATGATTTAAATAAAGAAATATAATTATATTGAATTTTACTCTAAAAGATTAAATGAGCGA
AGCAAATTTTTTGGTAAGAAAACAACAGAAGAAATTTTAACATTTAAAAAGACATGCATA
AAAGGAGGTAGCTTGATAAAGCTTCCTTCATCTGATATAGCTCATGCCCTTACACACTTT
GAAATATTATTATTATTTATCAAAGAAACAGATACTATTAAATACTCGGTGACATAATAA
TACTAAACATAAAGTTCGTATAATGATGGATAGGAGTCTAGAATTTAAAAACTTTTGAAG
TACTCTTAAAACAGGTCTTAAGAATTTAAAAATGAGGTCTTGACTTAAATTTTAAAATAG
TTAAATGGTAATAAAAACGATTTATACACTCTCCGTCTTCTTCACTACTTAGTAGTATTT
TGTTATTGCTTCAGAACTGATGAAGAGTATACTATGACTATGATAAATTTCTTAATTTTT
AATTTAATGAAATTTTGGCACTAACATAGCACTATATTAAAATACATAGAATATGTGATT
CCTACTTTGTTTCGCTCTATAACTTATTTAAAAGAAAGAGAGAATATTTACAATAAGCAT
GTTCTCACAGAAATGAAAATTAATGCTTTGATATTTTAATATCAAATAAAAGTTCCAATT
ACTCTTTCAAATGGGACCAGTTTTCTTGTGAATGTAGATCCATATGATAATTTTAACAAT
TTGAAATAAAAAGTCATGGAATAATTGAATATCAACCACCGTCGTCTGATCCCTGAATTA
TTTGAATTCTTCGAAATACAAACAAAAGAAAATTAAGTATTTGAAAGAATGCTTTTTCCA
TTAGAAGGAGTATGGGATGTTATTCATTTATAAGATACTTATAGAAATCAAAGTGCCTTT
GAAACGAAAAAAAATTAAAATTAAAAGAAGACTTTCTAATTTATGTTTAAACCTATTTTT
GTTTACACAGTTTATCCAAATGACGAAGTTGGTATTAGCTTACTCTAAAGCTAAATATAT
TTTGATACTTACATTTCAAATCTCGTTTATGATGATAAAAAAACTAACATACAGATGCTT
TCACATTTACTTAATATATTAGATATTTCCAACATTGAAGATCCAACAAGTATTCTACCT
TTAAGTTTTAGTGAAGAAGAGTCAAGGAGCATTTTTCAGCTTATTTAGGAGGAATACGAA
AAAAATATAAAAAATAAAATGACTAGGCTCTAATCAAAATTTGAATACATATAATTAGCC
AAAGATAATGTCAATCTTTTGGGATTAAAAATACCTATAAAATACTGTGATGAGCAAAAA
CAAACTAACGACCCTCTCAATTATTTGATGGTTTTAAACTCCTATTAGATGTCATTCTAC
GAAACTGCAAACAATAATCATCTAGTAATGCAATACAAGTACAGCTAGCTAATCAGCTGG
GGAGTCCAAGACAAATTTATAAAACTGAATACTAAAGACAATAAATCTCATATAATCAAT
ACTGAGTATGTTTTAACAGTTGTTTATTATTTTAATCAAGTCAAAGGGTTGGTAAAACAA
TAAGACGAACAATATTATCAATCTATGAAAAGCATATACTCTTCTATTAATACAAACTAA
AGATCAATTTAAAGTGCTTCAATACCACAAAATATAAAAACGTCAGAATCTCTTAAACAA
TATTAAAAATTATATAGCAATCAACTATTCTCTTCTAGTTAATAAAAAAAATTTAATTGA


>TTHERM_00600770(protein)
MSSQNKLPNSSTNQQQQGGNKNANNNPVKAKEADSTWVMSNVRCWYKKNNNREEQYIFRK
AIIVSDQVKNVGGQQIVNISIEQENGQNAEQIETNVKNLFQREEQSQTSFYDMVKMSVLN
EAELIANLKQRYAQDNIFTYIGPTLIVLNPYKSLKELFSNQTIDMIKENLNKNFDLFDLE
MQQPHIYSISAMAYKNLIKFNKKQAIVISGESGAGKTENARYSMRFLTQISTHDNSNESI
EEKILSCNPVLEAFGNAKTVRNDNSSRFGKYVQIEIAKKKINGATITKYLLEKSRVIHLS
QGERNYHIFYHLLESKDNQLLEKLHLLNKKPSEFQYLSQSDCYSVETIDDTQLFQGIINS
FKVMKFEEDLQNTIFKILSAILHLGNIQFSNQSFSEGSSPCTVVNENVLQIVSSLLGINL
DDLKKALLYKTIVAVNEVYHKPADAVQCHHAKNTLSKALYDNLFNWLVDKLNQIIKNNQV
NYNTTNTSNNNMIGLLDIFGFENFQENSFEQLCINYTNENLQQLYIQYVFKNEEQIFKED
GLENFLSNLCYQDNSMIIQTLNRSYKLLNDCCKTQSKDDSKYLQSLKNDFKNQQIQVIQF
PKMDNGTFLINHTQNPVSYKIEGFIAKNIDEVSQTLKDVISKSSNKYIPSIFGNEEQTQQ
NRARFLGEKFSNQMVELMKELNSSDVHFVRCVKTNEVKKSDYFLEGYVLQQIEYLGVINS
IEVRKSTYPQRRDYLTFFKEYRVCDEQLEKKAIDQIKNFKDECKALVSKMYPNYSDSLIL
FGNNKIYMKQEFESAIDQIKYAEIKRKRTAQVVRIQIYVRYLRFHKRFQKKLEGIKKLNN
IFFAQKIFNIYNHCFQLIKQKAKITQVKNLITLTLKIVKASFTKTTFQILKEYSDKMKEL
KEKNEAQIENNKQILEQSQEEQKVSESTCVSNQFLQRQDTSINETNASLLYDTIAVNEIQ
TEQSQSKVNTYSLKSEKQQNSQNVNAFDFQTGDLSLLHIPEKHTNEIYVNPPDQEEIESE
SLLLKLLNSQEIDDKIIQQMKQVQYALDKDYQIQQIDEEDMIQIKKYNYIEFYSKRLNER
SKFFGKKTTEEILTFKKTCIKGGSLIKLPSSDIAHALTHFEILLLFIKETDTIKYSVTQQ
YQTQSSYNDGQESRIQKLLKYSQNRSQEFKNEVLTQILKQLNGNKNDLYTLRLLHYLVVF
CYCFRTDEEYTMTMINFLIFNLMKFWHQHSTILKYIEYVIPTLFRSITYLKERENIYNKH
VLTEMKINALIFQYQIKVPITLSNGTSFLVNVDPYDNFNNLKQKVMEQLNINHRRLIPEL
FEFFEIQTKENQVFERMLFPLEGVWDVIHLQDTYRNQSAFETKKNQNQKKTFQFMFKPIF
VYTVYPNDEVGISLLQSQIYFDTYISNLVYDDKKTNIQMLSHLLNILDISNIEDPTSILP
LSFSEEESRSIFQLIQEEYEKNIKNKMTRLQSKFEYIQLAKDNVNLLGLKIPIKYCDEQK
QTNDPLNYLMVLNSYQMSFYETANNNHLVMQYKYSQLISWGVQDKFIKLNTKDNKSHIIN
TEYVLTVVYYFNQVKGLVKQQDEQYYQSMKSIYSSINTNQRSIQSASIPQNIKTSESLKQ
YQKLYSNQLFSSSQQKKFN


>TTHERM_00600770(gene)
ATGAGCAGCTAAAATAAGCTTCCTAATTCTTCTACAAATTAATAATAGCAGGGAGGAAAT
AAAAACGCTAACAATAACCCAGTAAAAGCCAAAGAGGCAGATAGCACTTGGGTTATGAGC
AACGTTAGATGCTGGTATAAGAAAAATAATAATAGAGAAGAGCAATACATATTTAGAAAA
GCAATTATAGTATCAGATTAAGTAAAGAATGTAGGCGGACAATAAATAGTTAACATAAGC
ATTGAATAGGAAAATGGCTAAAATGCTGAATAGATTGAGACAAATGTTAAAAATTTATTT
TAGAGAGAAGAACAAAGCCAAACATCATTTTACGACATGGTAAAAATGAGTGTTCTTAAT
GAGGCAGAATTGATTGCTAACTTAAAATAGAGATATGCATAAGACAATATCTTTACTTAT
ATCGGCCCTACTTTAATAGTTTTAAATCCTTACAAAAGTTTGAAAGAATTATTTTCTAAT
CAAACGATTGATATGATAAAAGAAAATTTAAATAAAAACTTTGATTTGTTTGATCTTGAA
ATGCAATAGCCTCACATATACTCTATTTCTGCAATGGCTTATAAAAATTTAATTAAGTTC
AATAAAAAGTAGGCAATAGTTATTAGCGGTGAAAGTGGTGCAGGTAAATTTTGTTTTGAT
TTATTTAGAAATATATTAATTTCATAAAATGATTTATTAAGGAAATTAAATACCAAAAAA
TACTTAAATAAATCTAAAAACTATTACTTACTTATTTACTTAATTAAGTATAAATCTTAC
CAATATTGATGTTCTTTTAATATTTTAAAAGGTAAGACAGAGAATGCAAGATATTCGATG
AGATTTTTAACTTAAATTAGTACTCATGATAACTCAAATGAAAGCATCGAAGAAAAAATA
TTATCCTGCAACCCTGTACTCGAAGCATTTGGAAATGCAAAAACAGTGAGAAATGATAAC
TCAAGTCGTTTTGGTAAATATGTATAAATTGAAATAGCTAAAAAGAAAATAAATGGAGCT
ACAATCACTAAATATCTACTTGAAAAAAGTAGAGTGATACATCTAAGCTAAGGAGAGAGA
AATTATCATATCTTTTATCACTTATTGGAGTCAAAAGATAATTAATTATTGGAAAAACTT
CATCTTTTAAATAAAAAACCATCTGAGTTTTAATACTTAAGTTAGAGTGACTGCTACTCT
GTAGAAACTATTGATGACACTTAATTATTTCAAGGAATTATTAATTCCTTCAAAGTTATG
AAATTCGAAGAAGACTTGCAAAATACTATTTTTAAAATACTATCTGCTATTTTACATTTA
GGAAACATTTAGTTTTCAAATTAATCATTTTCTGAGGGTTCATCACCATGCACAGTGGTA
AATGAAAATGTGCTACAGATAGTCAGTAGTTTACTAGGTATTAATTTAGATGATCTTAAG
AAAGCACTTCTTTATAAAACAATTGTAGCAGTGAATGAAGTATATCATAAACCAGCTGAT
GCAGTATAGTGTCATCATGCAAAAAATACTCTGAGTAAAGCACTTTATGATAACTTATTC
AACTGGCTAGTTGATAAATTAAACCAAATTATAAAAAATAATCAGGTAAACTATAACACA
ACAAACACCTCTAATAACAATATGATTGGATTACTTGATATTTTTGGTTTTGAAAACTTT
TAAGAAAATTCTTTTGAATAGCTTTGCATTAATTATACAAATGAGAATCTTTAGCAACTA
TACATTTAATATGTTTTTAAGAATGAAGAATAAATTTTTAAAGAAGACGGTTTAGAGAAT
TTCCTTTCAAATTTATGGTAAATTCCTTTTTAAGTTTTTTATATTTAATGTATTTTTTTT
GGAATAGCTATTAGGATAATTCAATGATCATTCAAACTTTAAATAGAAGTTACAAGCTGC
TTAACGATTGTTGCAAAACATAATCCAAAGACGATTCAAAATATTTATAGTCTCTTAAAA
ATGACTTTAAAAATCAATAAATATAAGTCATTCAATTTCCTAAAATGGATAATGGCACAT
TTTTGATAAATCACACATAGAATCCTGTTAGCTACAAAATTGAAGGATTTATAGCAAAGA
ATATCGATGAAGTAAGTTAAACCCTCAAAGATGTAATTAGTAAAAGTAGCAACAAATACA
TACCTTCTATCTTTGGTAATGAAGAATAAACATAATAAAATAGAGCAAGATTTTTAGGAG
AGAAATTTAGTAATTAAATGGTAGAGTTGATGAAAGAATTAAATTCTTCAGATGTTCATT
TTGTTAGATGTGTTAAGGTAAATTCACAATTAAAAATAACATTTGATTTATTATAGTTAA
TTTATAAAAATAGACAAATGAAGTTAAAAAAAGTGACTATTTCTTGGAAGGTTATGTATT
GCAATAAATAGAGTATCTGGGTGTTATAAACTCAATAGAAGTAAGGAAAAGCACTTATCC
CTAAAGAAGGGATTATTTAACTTTTTTTAAAGAGTATAGAGTTTGTGATGAGTAATTAGA
AAAAAAAGCAATAGATTAAATTAAAAATTTTAAAGATGAATGTAAAGCTTTAGTTTCAAA
GATGTATCCAAACTACAGTGACTCTCTTATTCTATTTGGTAATAATAAAATCTACATGAA
ATAGGAATTTGAAAGTGCTATTGATTAGATAAAGTATGCAGAAATAAAGCGTAAAAGGAC
TGCTTAAGTAGTAAGAATTCAGATTTATGTTAGGTACCTTAGATTCCATAAAAGGTTTTA
GAAAAAATTAGAAGGAATTAAAAAATTAAACAATATTTTCTTTGCACAGAAGATTTTTAA
TATATATAATCATTGCTTTTAACTAATTAAGTAAAAAGCTAAAATTACTTAAGTAAAAAA
TCTTATTACCTTAACGTTAAAAATAGTAAAAGCATCTTTTACAAAGACTACATTTTAAAT
TCTTAAAGAATATAGTGATAAAATGAAAGAATTAAAAGAAAAAAATGAAGCCTAAATAGA
GAATAATAAATAAATATTAGAGCAAAGTTAAGAAGAATAAAAGGTTAGCGAATCAACATG
TGTTTCAAATTAATTTTTACAAAGATAAGATACTAGCATAAATGAAACTAATGCATCTTT
GTTATATGATACTATAGCTGTTAATGAAATTTAAACTGAGTAATCATAAAGTAAGGTTAA
CACTTATAGCTTAAAAAGTGAAAAATAATAAAATTCTTAAAATGTGAATGCTTTTGATTT
TTAGACTGGAGACTTAAGTCTATTACACATCCCAGAGAAACATACAAATGAAATTTATGT
GAATCCTCCTGACTAAGAAGAAATAGAATCAGAAAGTCTTTTGCTTAAATTGTTGAATTC
CTAAGAAATAGACGATAAAATAATTTAGTAAATGAAGCAAGTCTAATATGCACTTGACAA
GGATTATCAAATTTAACAAATAGATGAGGAAGATATGATTTAAATAAAGAAATATAATTA
TATTGAATTTTACTCTAAAAGATTAAATGAGCGAAGCAAATTTTTTGGTAAGAAAACAAC
AGAAGAAATTTTAACATTTAAAAAGACATGCATAAAAGGAGGTAGCTTGATAAAGCTTCC
TTCATCTGATATAGCTCATGCCCTTACACACTTTGAAATATTATTATTATTTATCAAAGA
AACAGATACTATTAAATACTCGGTGACATAATAATACTAAACATAAAGTTCGTATAATGA
TGGATAGGAGTCTAGAATTTAAAAACTTTTGAAGTACTCTTAAAACAGGTCTTAAGAATT
TAAAAATGAGGTCTTGACTTAAATTTTAAAATAGTTAAATGGTAATAAAAACGATTTATA
CACTCTCCGTCTTCTTCACTACTTAGTAGTATTTTGTTATTGCTTCAGAACTGATGAAGA
GTATACTATGACTATGATAAATTTCTTAATTTTTAATTTAATGAAATTTTGGCACTAACA
TAGCACTATATTAAAATACATAGAATATGTGATTCCTACTTTGTTTCGCTCTATAACTTA
TTTAAAAGAAAGAGAGAATATTTACAATAAGCATGTTCTCACAGAAATGAAAATTAATGC
TTTGATATTTTAATATCAAATAAAAGTTCCAATTACTCTTTCAAATGGTAATTTTAATTT
TATTTTTTTAAAGCAATTTTCATTAATTTTTTTGTTTCGGTTTAAAAATTTTAAATATCA
TTTTACAAATTTTAGATGAAATTTGGAAAAATAAAGTTTAAAAAACTCATTTTTATTCGA
TTGAAAAAATTGAAAAAACAATTATTGAAAAAAATCCAATTGGTAATTTTAATTTTATTT
TTTTAAAGCAATTTTCATCAATTTTTTTGTTTCGGTTTAAAAATTTTTAATATCATTTTA
CAAATTTCATCACTAAAAATTGTAAAAATAAAGTTTAAAAAACTCATTTTTATTCGATTA
AAAAAACAATAATTGAAAAAAATAAGAGTTTTTCAGAGAATTGAATATTTCTCTTTTTCA
AATTTAATTTAATTTAATTTAAAGAAAAGAAAACTTAAATTATTGCTTTAATATTTATTG
CTTTTTAAACTTTATTTAGGGACCAGTTTTCTTGTGAATGTAGATCCATATGATAATTTT
AACAATTTGAAATAAAAAGTCATGGAATAATTGAATATCAACCACCGTCGTCTGATCCCT
GAATTATTTGAATTCTTCGAAATACAAACAAAAGAAAATTAAGTATTTGAAAGAATGCTT
TTTCCATTAGAAGGAGTATGGGATGTTATTCATTTATAAGATACTTATAGAAATCAAAGT
GCCTTTGAAACGAAAAAAAATTAAAATTAAAAGAAGACTTTCTAATTTATGTTTAAACCT
ATTTTTGTTTACACAGTTTATCCAAATGACGAAGTTGGTATTAGCTTACTCTAAAGCTAA
ATATATTTTGATACTTACATTTCAAATCTCGTTTATGATGATAAAAAAACTAACATACAG
ATGCTTTCACATTTACTTAATATATTAGATATTTCCAACATTGAAGATCCAACAAGTATT
CTACCTTTAAGTTTTAGTGAAGAAGAGTCAAGGAGCATTTTTCAGCTTATTTAGGAGGAA
TACGAAAAAAATATAAAAAATAAAATGACTAGGCTCTAATCAAAATTTGAATACATATAA
TTAGCCAAAGATAATGTCAATCTTTTGGGATTAAAAATACCTATAAAATACTGTGATGAG
CAAAAACAAACTAACGACCCTCTCAATTATTTGATGGTTTTAAACTCCTATTAGATGTCA
TTCTACGAAACTGCAAACAATAATCATCTAGTAATGCAATACAAGTACAGCTAGCTAATC
AGCTGGGGAGTCCAAGACAAATTTATAAAACTGAATACTAAAGACAATAAATCTCATATA
ATCAATACTGAGTATGTTTTAACAGTTGTTTATTATTTTAATCAAGTCAAAGGGTTGGTA
AAACAATAAGACGAACAATATTATCAATCTATGAAAAGCATATACTCTTCTATTAATACA
AACTAAAGATCAATTTAAAGTGCTTCAATACCACAAAATATAAAAACGTCAGAATCTCTT
AAACAATATTAAAAATTATATAGCAATCAACTATTCTCTTCTAGTTAATAAAAAAAATTT
AATTGA