Identifiers and Description

Gene Model Identifier

TTHERM_01035740

Standard Name

MYO2 (MYOsin )

Aliases

PreTt09585 | 206.m00058

Description

Myosin heavy chain; member of proposed myosin Class XX, distinct from previously defined myosin classes; contains predicted coiled-coil, myosin tail homology (MyTH4), and FERM domains

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_01035740

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_19646.19.997093137033517e-262myosin head, motor domain-cont
aining protein (1543 aa)
OxytrichaContig18292.0.g1084.999822746981985e-134Myosin head (motor domain)
DictyBaseDDB_G02886799.997006461365152e-115myoE on chromosome: 5 position
1829072 to 1832587
SGDYOR326W2.0009157491910723e-107MYO2 One of two type V myosin
motors (along with MYO4) invol
ved in actin-based transport o
f cargos; required for the pol
arized delivery of secretory v
esicles, the vacuole, late Gol
gi elements, peroxisomes, and
the mitotic spindle
WormBaseWBGene000020381.0002646133906571e-103locus:hum-5 status:Confirmed
UniProt:G5ECZ0 protein_id
:CAA84673.1

General Information

Paragraph NoGene NameParagraph Text
10MYO1,
MYO12,
MYO11,
MYO10,
MYO9,
MYO4 ,
MYO5,
MYO4,
MYO3,
MYO2,
MYO13
Proteins of the myosin superfamily are ATP-dependent molecular motors that travel unidirectionally along actin filaments. The myosin heavy chain proteins are comprised of three domains: a head (motor) domain responsible for ATP hydrolysis at the N-terminus, a neck (lever arm) region, and a C-terminal tail region. Thirteen predicted myosin heavy chain genes have been identified in the Tetrahymena genome and named MYO1-MYO13. A phylogenetic analysis comparing these predicted proteins with the 19 previously identified myosin classes suggests that Myo1p-Myo12p belong to a previously undescribed class of myosins. This new family, designated Class XX, does not include Myo13p, which did not branch with this class or any of the other classes in the analysis. The neck and tail regions of the Tetrahymena myosins include a variety of domains characterized in other myosin classes, with each protein containing one or more of the following domains: coiled-coil (which may support dimerization); IQ motif (binding sites for calmodulin or calmodulin-like proteins); FERM domain (Four-point-one protein, Ezrin, Radixin, Moesin homology); and MyTH4 domain (Myosin Tail Homology 4).

Associated Literature

  1. Ref:16505385: Foth BJ, Goedecke MC, Soldati D (2006) New insights into myosin evolution and classification. Proceedings of the National Academy of Sciences of the United States of America 103(10):3681-6
  2. Ref:15988740: Williams SA, Gavin RH (2005) Myosin genes in Tetrahymena. Cell motility and the cytoskeleton 61(4):237-43
  3. Ref:17821280: Harrison JA, Fowler EH (1945) AN ANTIGEN-ANTIBODY REACTION WITH TETRAHYMENA WHICH RESULTS IN DYSTOMY. Science (New York, N.Y.) 102(2638):65-6

Sequences

>TTHERM_01035740(coding)
ATGAGTATTGATTCACATTAAATAGAAAGAATTAAGACATCATGGATGCTTAATGGAGTT
TAATGCTGGGCTAAAGTAGCACCAGAGGAAAACTCCGAGCTTATGTTTCGTAGGGCTATT
ATTACAGGTTTAGATAATAAGCGTGAGCATGCATTCTTAAAATATGAGTTTCATCTTATC
TAAATTTAACAGCAAAAAGAAAAAGGTCCAGAAAAAGTACATGTTAGAGACTTAATAGAA
TGCAATTAGAATGCAGATAGTGAAAAATTTAAAGAAGGTTTTCCTGATATGGTTTCGATG
AATGTATTAAATGAAGCAGAAATTTTGAATAATGTTTGGTTGCGATATTCTAAAGACCTA
ATTTTTTCCTACATAGGACCTACATTAATTGTAATGAATCCCTACAAGAATGTAGAAAAG
CTTTTTAATGAAAAGGTTTTATAAGAATTTTAGAAACCTGCAATAAATAACAATTTCGAT
ATAAAGTAGCATTAGCCTCATGTCTATGCAGTAACTACATTAGCTTATTAGTAGCTATTT
ATGAATTAAAAGAACCAGGCAATAGTAATTAGTGGAGAATCAGGAGCTGGTAAGACTGAA
AATGCTAAATATTGTATGGCTTTTTTAACTTCTTTAAGTAATGAAACAACTAAGCAGTAA
CGCCCAAAAAAGAAAACTTAATTGGCGAACTAATTAAATAGATATTCTACAATGAGATAT
TCTTCAGTAGTAGCTAGCAACATCTCAGATTCTTAATATACTGAAGACTCTATACTTTAA
TTAAAGGATACATCGATTGAAGAGCGTATTCTTAGATGCAACCCAATTTTGGAAGCGTTT
GGTAATGCTAAAACAGTGAGAAATGATAATTCAAGTAGATTTGGTAAATATGTTCGTATT
TGGATTGGAAAGCATGATAAAAGAATTAAAGGAGCCTCAATTACAAATTACTTATTAGAA
AAAAGTAGAGTGACTCTACTATCATAAGGTGAAAGAAACTATCACATATTCTATCATTTT
TTATAAGGATTAGAAACTTCACAACTTAAAACTTATAAACTTGTGGAAAAAAATGGTAAT
AGAATAGATTTAAAAAATTTTAATTATTTAAATTAAACTAATGTGTACGAAATAAGCTCC
TTTCCTAGTGATAAAATAATGATTGATTAGATTATTGAATCCTTTGAGAAAATGGAGATT
GATTCATACTAGTAAGTAGCTATTTTTAAAGTTTTATCAGCTATTCTTTATATTGGAAAT
ATTGAGTTTGATAGCTCAACATATACAGATAATACTCCTTGTAGTATAAAAAACTAAGAT
ATCATATAAACTGTTTCTGAACTTTTAGAAATAAATTAGTAAGATAAAATTTTGAAGTCA
ATTATATTTAAAATACGTTAAGTTGGTAGCTAGGTTATGGAAACTCCAGTGAATGTTGAA
GAGTGCAAAATTAATAGGGATTCATTAGCGAGAGCTCTTTATGATAAAATGTTTACATGG
ATAGTTTAATCATTAAATATGGAAATTTTACCTTAGAATAGTAATCCTAACGAATGTTTA
AGTCTCGGATTGCTAGATATTTTTGGGTTTGAGAACTTTAAGGTCAATTCTTTTGAATAA
TTATGCATCAACTTCACAAATGAGCGCTTGCAATAGCTATATATTGTATATGTGTTTAAA
GCTGAAGAAGAAGAGTTTAAAAAAGAAGGTCTTAAAGTCCATAGCTTAGAACTTTCTTAT
TAAGATAATTAAGTTATTATAGATACAATGGATAAGCCACCTAATGGTATTTTTGATCTT
CTAGATGAAAGTTGTTCTTTAGGAAATTCAACAGATGAAAAGTTTTACTAAAAAATTGTT
TCAACCTACTCTAAAAATGATTAAATTAAGATACCAAAAATTTAAAACATGAAATTCTCA
ATTGTACATACTGCAAAAGAAGTTGAATACACAGCTGATGGCTTTAGAAATAAAAATAAA
GATGAGATTTCTACTTTTCTAGATTAATGCATATCGTCATCTAGTAGTTCTGAAATATGT
TCTATATGGTAAGGAATTGGAGAAGTTAATATGACAGATATGGAGGTTTCTTCAAAAACA
GTGCAGGATATGTCAATTTCAGTGAGAAATACTTAGAAAAAATTAGAAAATAAGGGAAAA
GCTCAAAAATTTTTAGGAGCAAAATTCAGGGCTTAAATGAAAGATCTTATGGGAGAACTT
AATTCTTGTGATGTACATTTTATTAGATGTATTAAGCCTAATGAAGATAAAGTAAAAGAA
AAATTTGTTAGTCAATATGTACTCTTGCAGATAAGATATTTAGGTATTTTGGAAAGTATT
AAGGTGAGAAGAGAAGGATTTCCATGTAGAATGAGCTATGAAGAATTTTACACTAAATAT
CATGAGCTTGATGTTTTTAATAGAAAAATAACATTATAGAGGCACTTAGATATGAAACAA
GATATGCCAGGATTGTGTAGAGAATTGTTATTTAGAGTTGTAAAAGATGTTAACAAAAAA
GAAGTTCTATTTGGTTAAACTAAGTTGTACTTAAAAGTTTAGCCATCAACAGAGTTAGAT
AATAGATTAATTAAATGGTGGTAGTTTAAAAATGATTAGGCTGGTAAAATCTAAGGATAG
TGGGAAGTTTACAATAACAGAAAAGTTATTAAAGAAAATTTAAAGATTATAAAAAATGCT
GTTAAAAGTTTTGTTAAACTTTAAGCTATTTATAAAATGAAAGTCTAAAAAAAAGCATAT
CTTAAGACATTATAATAGAAAAAGGGAATAGAAATACTTTAGAAAATACAAAAAAAAATG
CAACAAGCTAAATTAAAAGAAGTACTAAAACTATGGGTGGATAAAATAAAAACATAAAAA
AAGGGAGATAAATGGTCTAATGCAGTATCGAAAGTTTGTAATATAAGTAAAAGAAACCAT
GTGAGAGATATCAAAGAATACTGGCTTAGATGGAAGAATTTTATCAAATCTGAATAAGAA
AAAGAATTACAAAACAAAATAAAAGAATAGGAAGCAAAAGCTATTGAACAAAATAAAGCA
ATAGAAGAATAAAAGCAAATAGAAAAAGAAGTAGAGGAAGAGGAAGAAAAAAAAGATGAT
GTTAAGGAATTAGAATAAGTAAAACCTTAAGAACCTGTAGTTTAAAAGAAGATTAACCCT
AATGGACTTGAAATGGAAAGAGAAGATATAAAGTCAGACGAGTTTACTTCTTAGGGTCTA
AAAATTTGGCCTAACTTTTCAAACTTTACTAAGCCTTATAATTTATAAAATAAATTCTCT
ATCCCTAATGATATTTTAGACAATAATTAAAAATACTAAAATCCTAAGGAGCCAGAATAA
AAAGACTTATAAAATTTAGAGTTTAGTGATTAGTTTCTTTAATTAGTTCAATAATCATCA
TTCTTAGAATATTGCAATAATAATGTAAAAAGAGCTAAGAATTTCAGTAAAAAAATGTAA
ATTGCTAAAATAATGCAATACTAATCAAATAATCTAAGTGAATCTCTACTCTAACAATCA
GATTCATTCAATGAAGATGCTACTAAGATTTTTAGATCTTTATTAAAAATCTCTGGAAAT
AGAAATTCTCGTTTCTCTCCTAGATACCATTCTGATCTGATATTAAATCTATGTTATGGA
AGGGATTCGGAATTAGATCCTAACTGCTATGTGATAGGTAAAAAAGTGGAAAATCCAGAA
GATTAAAAAAAATAAAATAATAGAAGAGAATCTAAAGAAAATAAAGATCTTGATTAGAGA
AGAGGAAGCTATTTAAAAAATTACTCATCATAGGTATGCTAAAAATAATAAGGGAAAAAT
GGTGATTCAAATCAAGAAGAGGATGATTTAAGCCATGAAAACAAATTAGAATTAATGGCT
AACTAAATCCTTCATGGTAATTTAAATCATATAAGGGATGAAGTCTACTTTTAAATATGC
AAATAGATTGCTGGAAACAAATCCTAAGAGGCTAAAAAAAATTTATACAAATTTGCAGCT
GAAATGTCCAATTTATTCGCACCTTCTTAGGATGCCCTCTATCCATTAATAAATTTCTTC
ATGGATTAATCATTACAAGATCCAAATGCTTAAAATAAAGAAGATGCTAAGTATATCGTC
AGTAAACTTTCTGAATTTGCTAGAGGATATGCAGTAGTTAAATTAATGAACCCTGATCAG
TTAAAAAAATAAAGTATTTTAAAGGTATTAAAGAATAATGATCCCCTTGAATTACAACTT
TAAAAAAATAATAATTAGTAAGTCTTGATTAACTATATAAACAAGATGTAACCCAGATAA
TTAATTCCTTCACATCAAGAAGTCTCAAAAATTCATAATAGATAGTAAATATGCATAAAA
ATATATTTATTTGATGGTACCTATATTTGGGTTCCTGCTGAATCATTAGAAACTGTTAAA
AGCATAGTAGAAAAAGCATGTAGCCAAATCGATATGAAAGAACGTTATTAATTTTTTAGC
CTCTATGAAGTTCTTTATGAGTAAGGAAAGGTTATGAAAGAAGCTTTTTTATTTGACAGA
GTTAAAATAATGGATATTTTTAATTCCCATCAAATTACAACAGAGCTATAACAGAAAAAA
CATTCTAAAAATATTGAATTCAGAATTTATCTTAGGATAAGAGTTTATTACAAGCTTTTT
AAAGATGATATAGATTCGATAAATATGTTTTATATGCAAAATATATATGAAGTAAACTAA
GGAAGGCTACCCTTAACTGAAAACTAAATAACTTAATTAGCTGCTCATTACTGCTATTCA
TCTCTAAAAACTTAACAGGGAAATGAGAAGAATATAGAAAATATGATAAATAAAGCTGTG
CCTTAGTACGCAATTCAAAAGTATCATAATAGACAATGGGGTAATGAAGTAAGTGAAATT
TATAAAAAACTTGAATACTAAAATGCTTTAGAAGCAAGATGGATGTATCTTGAAATAATC
AGACCTCATGATCTCTTTTTAAGCTACTAATTTGAATGCAGAATGTTTGTCTAATAAAAA
ACCGATTAGGGTTATAAGCTAGTTTAAAATTAATAGATAATTTTAGGTATTAGACCTTTG
TAAATAGTTATTTCTGATTTAGAACGTAAAACTATGTTGATAATTGATTTTTCTGAAATG
ACTAAATGGGGATAAAGCATAAGTAGTAACTCCTACTTTCTAATATAGCATGAAAATTCA
AACCTTTATGTGTTTGAAGTGTAAGATGTGGAGTTGGCTGATTATCTAATTAATGCATAT
GTAAATTGGAAACTCGAAAGAAATCTTGATGATGCTTCGAACCCCACTTACAGTGATGTT
ATTACTTTCTTAGTTTCTGATAATGATCAAGCAAATTAAATTAAATGA


>TTHERM_01035740(protein)
MSIDSHQIERIKTSWMLNGVQCWAKVAPEENSELMFRRAIITGLDNKREHAFLKYEFHLI
QIQQQKEKGPEKVHVRDLIECNQNADSEKFKEGFPDMVSMNVLNEAEILNNVWLRYSKDL
IFSYIGPTLIVMNPYKNVEKLFNEKVLQEFQKPAINNNFDIKQHQPHVYAVTTLAYQQLF
MNQKNQAIVISGESGAGKTENAKYCMAFLTSLSNETTKQQRPKKKTQLANQLNRYSTMRY
SSVVASNISDSQYTEDSILQLKDTSIEERILRCNPILEAFGNAKTVRNDNSSRFGKYVRI
WIGKHDKRIKGASITNYLLEKSRVTLLSQGERNYHIFYHFLQGLETSQLKTYKLVEKNGN
RIDLKNFNYLNQTNVYEISSFPSDKIMIDQIIESFEKMEIDSYQQVAIFKVLSAILYIGN
IEFDSSTYTDNTPCSIKNQDIIQTVSELLEINQQDKILKSIIFKIRQVGSQVMETPVNVE
ECKINRDSLARALYDKMFTWIVQSLNMEILPQNSNPNECLSLGLLDIFGFENFKVNSFEQ
LCINFTNERLQQLYIVYVFKAEEEEFKKEGLKVHSLELSYQDNQVIIDTMDKPPNGIFDL
LDESCSLGNSTDEKFYQKIVSTYSKNDQIKIPKIQNMKFSIVHTAKEVEYTADGFRNKNK
DEISTFLDQCISSSSSSEICSIWQGIGEVNMTDMEVSSKTVQDMSISVRNTQKKLENKGK
AQKFLGAKFRAQMKDLMGELNSCDVHFIRCIKPNEDKVKEKFVSQYVLLQIRYLGILESI
KVRREGFPCRMSYEEFYTKYHELDVFNRKITLQRHLDMKQDMPGLCRELLFRVVKDVNKK
EVLFGQTKLYLKVQPSTELDNRLIKWWQFKNDQAGKIQGQWEVYNNRKVIKENLKIIKNA
VKSFVKLQAIYKMKVQKKAYLKTLQQKKGIEILQKIQKKMQQAKLKEVLKLWVDKIKTQK
KGDKWSNAVSKVCNISKRNHVRDIKEYWLRWKNFIKSEQEKELQNKIKEQEAKAIEQNKA
IEEQKQIEKEVEEEEEKKDDVKELEQVKPQEPVVQKKINPNGLEMEREDIKSDEFTSQGL
KIWPNFSNFTKPYNLQNKFSIPNDILDNNQKYQNPKEPEQKDLQNLEFSDQFLQLVQQSS
FLEYCNNNVKRAKNFSKKMQIAKIMQYQSNNLSESLLQQSDSFNEDATKIFRSLLKISGN
RNSRFSPRYHSDLILNLCYGRDSELDPNCYVIGKKVENPEDQKKQNNRRESKENKDLDQR
RGSYLKNYSSQVCQKQQGKNGDSNQEEDDLSHENKLELMANQILHGNLNHIRDEVYFQIC
KQIAGNKSQEAKKNLYKFAAEMSNLFAPSQDALYPLINFFMDQSLQDPNAQNKEDAKYIV
SKLSEFARGYAVVKLMNPDQLKKQSILKVLKNNDPLELQLQKNNNQQVLINYINKMQPRQ
LIPSHQEVSKIHNRQQICIKIYLFDGTYIWVPAESLETVKSIVEKACSQIDMKERYQFFS
LYEVLYEQGKVMKEAFLFDRVKIMDIFNSHQITTELQQKKHSKNIEFRIYLRIRVYYKLF
KDDIDSINMFYMQNIYEVNQGRLPLTENQITQLAAHYCYSSLKTQQGNEKNIENMINKAV
PQYAIQKYHNRQWGNEVSEIYKKLEYQNALEARWMYLEIIRPHDLFLSYQFECRMFVQQK
TDQGYKLVQNQQIILGIRPLQIVISDLERKTMLIIDFSEMTKWGQSISSNSYFLIQHENS
NLYVFEVQDVELADYLINAYVNWKLERNLDDASNPTYSDVITFLVSDNDQANQIK


>TTHERM_01035740(gene)
TAAGAAATACCCATAAAATAAGTGTAGTTTAGTATTTATTAGCTTACTTTTACTTAATTA
ATAAATCATAATAAATTGAATATTGATTTTTTAATCTAAATGAGTATTGATTCACATTAA
ATAGAAAGAATTAAGACATCATGGATGCTTAATGGAGTTTAATGCTGGGCTAAAGTAGCA
CCAGAGGAAAACTCCGAGCTTATGTTTCGTAGGGCTATTATTACAGGTTTAGATAATAAG
CGTGAGCATGCATTCTTAAAATATGAGTTTCATCTTATCTAAATTTAACAGCAAAAAGAA
AAAGGTCCAGAAAAAGTACATGTTAGAGACTTAATAGAATGCAATTAGAATGCAGATAGT
GAAAAATTTAAAGAAGGTTTTCCTGATATGGTTTCGATGAATGTATTAAATGAAGCAGAA
ATTTTGAATAATGTTTGGTTGCGATATTCTAAAGACCTAATTTTTTCCTACATAGGACCT
ACATTAATTGTAATGAATCCCTACAAGAATGTAGAAAAGCTTTTTAATGAAAAGGTTTTA
TAAGAATTTTAGAAACCTGCAATAAATAACAATTTCGATATAAAGTAGCATTAGCCTCAT
GTCTATGCAGTAACTACATTAGCTTATTAGTAGCTATTTATGAATTAAAAGAACCAGGCA
ATAGTAATTAGTGGAGAATCAGGAGCTGGTAAGACTGAAAATGCTAAATATTGTATGGCT
TTTTTAACTTCTTTAAGTAATGAAACAACTAAGCAGTAACGCCCAAAAAAGAAAACTTAA
TTGGCGAACTAATTAAATAGATATTCTACAATGAGATATTCTTCAGTAGTAGCTAGCAAC
ATCTCAGATTCTTAATATACTGAAGACTCTATACTTTAATTAAAGGATACATCGATTGAA
GAGCGTATTCTTAGATGCAACCCAATTTTGGAAGCGTTTGGTAATGCTAAAACAGTGAGA
AATGATAATTCAAGTAGATTTGGTAAATATGTTCGTATTTGGATTGGAAAGCATGATAAA
AGAATTAAAGGAGCCTCAATTACAAATTACTTATTAGAAAAAAGTAGAGTGACTCTACTA
TCATAAGGTGAAAGAAACTATCACATATTCTATCATTTTTTATAAGGTAATTATTGAATC
TTTCATTATTTTCAAAACATTTTGATTAAAAAGAAATGCATACAGTATTATTCATATAAA
TAGATTACTTAACATTTAGATTTTTAATTAAATTAGCTACATTTAATTCCAAAAGAATTT
ATCAATCTATATTAATTATAATTAAAATTTGATCCTTGAGAATTAATATTGGTGTAACTA
TTTTAAATTAAAAAATTCAATAAATTTTTAGGAAATTTGTTTCCCATAAAATTGACAAAA
AATTAAATCATAAGATAGTTATGAATAAATAAATTATAACTAAAATACTCAAATAATTTT
ATTTATTTTAGATCAAAATATTTATTTTAAGTAAAGCAAATTAAGAAATTTACTAAGTAA
AATAATTTCAACGAAATTAAATTTTTTATTCATATTTTTAACAAATTTACTGAAGAAATA
TGTAGGAATTGTTTATATAAAGCTAAGATTAAGCAAGAAATAAAATTAGATTTTATTTTT
TATATTTTTCCTTATCTATTAAAATATAAAATTTCATAAAAATATATAAAAAGTAATAGT
TTTGAATTTGGTATAATTTATTTATTTAAAATAGGATTAGAAACTTCACAACTTAAAACT
TATAAACTTGTGGAAAAAAATGGTAATAGAATAGATTTAAAAAATTTTAATTATTTAAAT
TAAACTAATGTGTACGAAATAAGCTCCTTTCCTAGTGATAAAATAATGATTGATTAGATT
ATTGAATCCTTTGAGAAAATGGAGATTGATTCATACTAGTAAGTAGCTATTTTTAAAGTT
TTATCAGCTATTCTTTATATTGGAAATATTGAGTTTGATAGCTCAACATATACAGATAAT
ACTCCTTGTAGTATAAAAAACTAAGATATCATATAAACTGTTTCTGAACTTTTAGAAATA
AATTAGTAAGATAAAATTTTGAAGTCAATTATATTTAAAATACGTTAAGTTGGTAGCTAG
GTAAATTATTACTTTTAAAATGACTTTATATTGAAAATATAATCTAAAAATAAGGTTATG
GAAACTCCAGTGAATGTTGAAGAGTGCAAAATTAATAGGGATTCATTAGCGAGAGCTCTT
TATGATAAAATGTTTACATGGATAGTTTAATCATTAAATATGGAAATTTTACCTTAGAAT
AGTAATCCTAACGAATGTTTAAGTCTCGGATTGCTAGATATTTTTGGGTTTGAGAACTTT
AAGGTCAATTCTTTTGAATAATTATGCATCAACTTCACAAATGAGCGCTTGCAATAGCTA
TATATTGTATATGTGTTTAAAGCTGAAGAAGAAGAGTTTAAAAAAGAAGGTCTTAAAGTC
CATAGCTTAGAACTTTCTTATTAAGATAATTAAGTTATTATAGATACAATGGATAAGCCA
CCTAATGGTATTTTTGATCTTCTAGATGAAAGTTGTTCTTTAGGAAATTCAACAGATGAA
AAGTTTTACTAAAAAATTGTTTCAACCTACTCTAAAAATGATTAAATTAAGGTACTATTT
GATTTTTCTTATTTAAATCTTTAAAAAAATTTGTTTAATTTGAAAAATAAAACCAATAAA
ATTTAGCCTTAAATATTTAATTTTTAAAAAATAAAATTATTTAAGATACCAAAAATTTAA
AACATGAAATTCTCAATTGTACATACTGCAAAAGAAGTTGAATACACAGCTGATGGCTTT
AGAAATAAAAATAAAGATGAGATTTCTACTTTTCTAGATTAATGCATATCGTCATCTAGT
AGTTCTGAAATATGTTCTATATGGTAAGGAATTGGAGAAGTTAATATGACAGATATGGAG
GTTTCTTCAAAAACAGTGCAGGATATGTCAATTTCAGTGAGAAATACTTAGAAAAAATTA
GAAAATAAGGGAAAAGCTCAAAAATTTTTAGGAGCAAAATTCAGGGCTTAAATGAAAGAT
CTTATGGGAGAACTTAATTCTTGTGATGTACATTTTATTAGATGTATTAAGCCTAATGAA
GATAAAGTAAAAGAAAAATTTGTTAGTCAATATGTACTCTTGCAGATAAGATATTTAGGT
ATTTTGGAAAGTATTAAGGTGAGAAGAGAAGGATTTCCATGTAGAATGAGCTATGAAGAA
TTTTACACTAAATATCATGAGCTTGATGTTTTTAATAGGTAAATTAATAGGACAAGAATC
TTTTAATAACTTTTTTTTTAGAAAAATAACATTATAGAGGCACTTAGATATGAAACAAGA
TATGCCAGGATTGTGTAGAGAATTGTTATTTAGAGTTGTAAAAGATGTTAACAAAAAAGA
AGTTCTATTTGGTTAAACTAAGTTGTACTTAAAAGTTTAGCCATCAACAGAGTTAGATAA
TAGATTAATTAAATGGTGGTAGTTTAAAAATGATTAGGCTGGTAAAATCTAAGGATAGTG
GGAAGTTTACAATAACAGAAAAGTTATTAAAGAAAATTTAAAGATTATAAAAAATGCTGT
TAAAAGTTTTGTTAAACTTTAAGCTATTTATAAAATGAAAGTCTAAAAAAAAGCATATCT
TAAGACATTATAATAGAAAAAGGGAATAGAAATACTTTAGAAAATACAAAAAAAAATGCA
ACAAGCTAAATTAAAAGAAGTACTAAAACTATGGGTGGATAAAATAAAAACATAAAAAAA
GGGAGATAAATGGTCTAATGCAGTATCGAAAGTTTGTAATATAAGTAAAAGAAACCATGT
GAGAGATATCAAAGAATACTGGCTTAGATGGAAGAATTTTATCAAATCTGAATAAGAAAA
AGAATTACAAAACAAAATAAAAGAATAGGAAGCAAAAGCTATTGAACAAAATAAAGCAAT
AGAAGAATAAAAGCAAATAGAAAAAGAAGTAGAGGAAGAGGAAGAAAAAAAAGATGATGT
TAAGGAATTAGAATAAGTAAAACCTTAAGAACCTGTAGTTTAAAAGAAGTAAGTTTAAAG
TTAAATAGTTATTTAAATTTTATAAAAAACTTTAATTTATCAATCAGGATTAACCCTAAT
GGACTTGAAATGGAAAGAGAAGATATAAAGTCAGACGAGTTTACTTCTTAGGGTCTAAAA
ATTTGGCCTAACTTTTCAAACTTTACTAAGCCTTATAATTTATAAAATAAATTCTCTATC
CCTAATGATATTTTAGACAATAATTAAAAATACTAAAATCCTAAGGAGCCAGAATAAAAA
GACTTATAAAATTTAGAGTTTAGTGATTAGTTTCTTTAATTAGTTCAATAATCATCATTC
TTAGAATATTGCAATAATAATGTAAAAAGAGCTAAGAATTTCAGTAAAAAAATGTAAATT
GCTAAAATAATGCAATACTAATCAAATAATCTAAGTGAATCTCTACTCTAACAATCAGAT
TCATTCAATGAAGATGCTACTAAGATTTTTAGATCTTTATTAAAAATCTCTGGAAATAGA
AATTCTCGTTTCTCTCCTAGATACCATTCTGATCTGATATTAAATCTATGTTATGGAAGG
TTGATAATACTCTTTTTTATATTTTGAATTTTACATTTAAATTTTATTTTATTCTATTTA
TAGGGATTCGGAATTAGATCCTAACTGCTATGTGATAGGTAAAAAAGTGGAAAATCCAGA
AGATTAAAAAAAATAAAATAATAGAAGAGAATCTAAAGAAAATAAAGATCTTGATTAGAG
AAGAGGAAGCTATTTAAAAAATTACTCATCATAGGTATGCTAAAAATAATAAGGGAAAAA
TGGTGATTCAAATCAAGAAGAGGATGATTTAAGCCATGAAAACAAATTAGAATTAATGGC
TAACTAAATCCTTCATGGTAATTTAAATCATATAAGGGATGAAGTCTACTTTTAAATATG
CAAATAGATTGCTGGAAACAAATCCTAAGAGGCTAAAAAAAATTTATACAAATTTGCAGC
TGAAATGTCCAATTTATTCGCACCTTCTTAGGATGCCCTCTATCCATTAATAAATTTCTT
CATGGATTAATCATTACAAGATCCAAATGCTTAAAATAAAGAAGATGCTAAGTATATCGT
CAGTAAACTTTCTGAATTTGCTAGAGGATATGCAGTAGTTAAATTAATGAACCCTGATCA
GTTAAAAAAATAAAGTATTTTAAAGGTATTAAAGAATAATGATCCCCTTGAATTACAACT
TTAAAAAAATAATAATTAGTAAGTCTTGATTAACTATATAAACAAGATGTAACCCAGATA
ATTAATTCCTTCACATCAAGAAGTCTCAAAAATTCATAATAGATAGTAAATATGCATAAA
AATATATTTATTTGATGGTACCTATATTTGGGTTCCTGCTGAATCATTAGAAACTGTTAA
AAGCATAGTAGAAAAAGCATGTAGCCAAATCGATATGAAAGAACGTTATTAATTTTTTAG
CCTCTATGAAGTTCTTTATGAGTAAGGAAAGGTTATGAAAGAAGCTTTTTTATTTGACAG
AGTTAAAATAATGGATATTTTTAATTCCCATCAAATTACAACAGAGCTATAACAGAAAAA
ACATTCTAAAAATATTGAATTCAGAATTTATCTTAGGATAAGAGTTTATTACAAGCTTTT
TAAAGATGATATAGATTCGATAAATATGTTTTATATGCAAAATATATATGAAGTAAACTA
AGGAAGGCTACCCTTAACTGAAAACTAAATAACTTAATTAGCTGCTCATTACTGCTATTC
ATCTCTAAGTAATTAATCATTTTTTAAAAAAATATTAAACTTTAATCTATTAAATTAAAA
AACTGTTTTAAAAGTACCAATTAAATTTATTCTACCTCAAACAAACATAATTTAATGTAA
TAAATTTTTCCTAATTAAAAAAGTGCTTAAGCTTAAAAATTGGTTATAATTATTTTTTTT
TTCCATAAAATATTATGAATTTTATTTACTTACTATATTCCCTTATTTCTCAAATCTTGT
AATTAGCAAAAAGAAGTGAAGTATATGAAAAATTTTTTCTTAATAGTATCAAAAAATAGT
CAAAAATAATGTTTTTTTTTTGTAGGGAATATGGTATTTAGTAAAATTTAATCTAAAAAT
AAAAAATATTTTAATTTAAAATTAGAAACTTAACAGGGAAATGAGAAGAATATAGAAAAT
ATGATAAATAAAGCTGTGCCTTAGTACGCAATTCAAAAGTATCATAATAGACAATGGGGT
AATGAAGTAAGTGAAATTTATAAAAAACTTGAATACTAAAATGCTTTAGAAGCAAGATGG
ATGTATCTTGAAATAATCAGACCTCATGATCTCTTTTTAAGCTACTAATTTGAATGCAGA
ATGTTTGTCTAATAAAAAACCGATTAGGGTTATAAGCTAGTTTAAAATTAATAGATAATT
TTAGGTATTAGACCTTTGTAAATAGTTATTTCTGATTTAGAACGTAAAACTATGTTGATA
ATTGATTTTTCTGAAATGACTAAATGGGGATAAAGCATAAGTAGTAACTCCTACTTTCTA
ATATAGCATGAAAATTCAAACCTTTATGTGTTTGAAGTGTAAGATGTGGAGTTGGCTGAT
TATCTAATTAATGCATATGTAAATTGGAAACTCGAAAGAAATCTTGATGATGCTTCGAAC
CCCACTTACAGTGATGTTATTACTTTCTTAGTTTCTGATAATGATCAAGCAAATTAAATT
AAATGATTTTAAGACAGTTTTCAAAAATAAAAAAAACTTAAATTAACTAAAAACTTTACT
ACCTATCTAAAAATTATTTTAAATTTAAATATATATTCATTTTATAAAACTTTATTTTAA
TAAATACTAAATC