Identifiers and Description

Gene Model Identifier

TTHERM_00059050

Standard Name

MYO11 (MYOsin)

Aliases

PreTt13089 | 4.m00488 | 3707.m00133

Description

Myosin like protein; fusion of a myosin and an RCC1 protein; member of proposed myosin Class XX, distinct from previously defined myosin class

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

  • ( TIGR01612 ) rhoptry protein
  • ( PF00063 ) Myosin head (motor domain)
  • ( PF00612 ) IQ calmodulin-binding motif
  • ( TIGR00864 ) polycystin cation channel protein
  • ( PF04508 ) Viral A-type inclusion protein repeat
  • ( PF00415 ) Regulator of chromosome condensation (RCC1)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00059050

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02008.19.997093137033517e-262myosin like protein (1616 aa)
OxytrichaContig18292.0.g1087.9987533182317575e-115Myosin head (motor domain)
DictyBaseDDB_G02886797.000768000322042e-106myoE on chromosome: 5 position
1829072 to 1832587
WormBaseWBGene000020364.0008598455422075e-100locus:hum-2 status:Confirmed
UniProt:Q95ZU1 protein_id
:CCD68601.1
SGDYAL029C3.9981372112117256e-92MYO4 One of two type V myosin
motors (along with MYO2) invol
ved in actin-based transport o
f cargos; required for mRNA tr
ansport, including ASH1 mRNA,
and facilitating the growth an
d movement of ER tubules into
the growing bud along with She
3p
Stentor CoeruleusSteCoe_40800.000000000000001713908431542013

General Information

Paragraph NoGene NameParagraph Text
10MYO1,
MYO12,
MYO11,
MYO10,
MYO9,
MYO4 ,
MYO5,
MYO4,
MYO3,
MYO2,
MYO13
Proteins of the myosin superfamily are ATP-dependent molecular motors that travel unidirectionally along actin filaments. The myosin heavy chain proteins are comprised of three domains: a head (motor) domain responsible for ATP hydrolysis at the N-terminus, a neck (lever arm) region, and a C-terminal tail region. Thirteen predicted myosin heavy chain genes have been identified in the Tetrahymena genome and named MYO1-MYO13. A phylogenetic analysis comparing these predicted proteins with the 19 previously identified myosin classes suggests that Myo1p-Myo12p belong to a previously undescribed class of myosins. This new family, designated Class XX, does not include Myo13p, which did not branch with this class or any of the other classes in the analysis. The neck and tail regions of the Tetrahymena myosins include a variety of domains characterized in other myosin classes, with each protein containing one or more of the following domains: coiled-coil (which may support dimerization); IQ motif (binding sites for calmodulin or calmodulin-like proteins); FERM domain (Four-point-one protein, Ezrin, Radixin, Moesin homology); and MyTH4 domain (Myosin Tail Homology 4).

Associated Literature

  1. Ref:16505385: Foth BJ, Goedecke MC, Soldati D (2006) New insights into myosin evolution and classification. Proceedings of the National Academy of Sciences of the United States of America 103(10):3681-6
  2. Ref:15988740: Williams SA, Gavin RH (2005) Myosin genes in Tetrahymena. Cell motility and the cytoskeleton 61(4):237-43

Sequences

>TTHERM_00059050(coding)
ATGATGCAATTTGAGGAAGGAGCACCAGTTTGGTATTCTCTTAAAGAAGGTCTGAAGAAT
ACTTCAAAATAAGCTGATGCACCTGCTTTCGTAGAATCAGTAGTCATTTCTGTAATTGAT
AAAAATAAATCTTTAATATAATTGCTAGATTAGCCCAGCCCTTCAATACTAAGCTTGCTT
AATGAGAAACAAGCTAACTAGGCAAAGCCTTCTAATTTATAAATTCAATAAGGTGGAAAT
TAAAACTTAATTGTTGTTGATAATATTTTTTTGGAACCTAGATATGATAAAGAGGATGGA
GATTATTCTTCAATAAATGATTTAGTTAACCTTCCTTTTTTAAATGAACCTGAATTGCTT
AAAGCAATAGCTCAAAGATATGTTTAGGATAAAATATTTAGCTATGTTGGTCCTACTCTT
GTTGTAGTAAATCCTTATAAAAGAATGGATCATCTATTTAATGAAAAAACACAAGAATTG
TACTAAGAGAAAGTTATTTAAAATTAAGATATTTACTCTGAATAGCCTCACATATTTGGA
ATAGCTGCTTATTGTATGCAAAGTATTTTGTAAGAAAAAACACTTAAATAAGCGATTGTA
ATATCAGGAGAGTCTGGTGCAGGTAAGACTGAAAATACAAAATATGCTATGAAATTTTTA
ACCCAAATGAATGCTTAATTTTAATAGTAAAATACACCTTAAACTTTGACTAATTTGAGA
GAAAGCTACTTAAACTTAAAATCTAGATAAACTCTAAAATCAACTGTCTCTATAGAATAA
AGAATATTAAACTGCAATCCAATTTTAGAAGCTTTTGGTAATGCTAAAACAACAAGAAAT
GATAATTCATCTAGATTTGGAAAATTAGTTATCTTGCATTTAAAGGAAGATATTGGTTCT
TCATTTTCAATCAAGTAAAAGTAAAAAAAACTAGTAATTTCGTCTGCTTCTCTTACAAAC
TACTTGCTAGAAAAAAGCAGGATAGTTTAAATTTCGCAATAAGAAAGGAATTATCATATT
TTTTATCATCTTCTAAAAGGAGCTGAGCCTCAATTTCTTTCTCAATTAGGATTGAGTCCA
GATATTTCTTCTTATAGGTATTTAAAAAGTGAGTGCAGTAATGTTGATACTTTATCTGAT
GAATAGCTGTTTTTAGAAGTTATGTCAAGTTTAGATGATTTGAATTTTACTGAAATAGAA
TAAAAGGGAATTTGGAATATAGTTAGCTGTGTCCTTTTGTTAGGAAATCTAGATTTTGAA
GAAGTTAAAACAACAGGCGATTCTTGCACTATTTCGCCTAAATAGAAATAAACAGTAGAA
ACTATATGTAAAAAGCTTTAGTGTACTGAAAAAGAATTAAATGACGCTTTAACAACTAAA
AAAAGATAAGTTAACAACAATGTTACAACTTCTCCTCTTTCTATCAAAGAGTCAATAGAT
AATAGAGACTCTTACAGTAAATTTTTATATGAAAAGCTATTCAATTGGATAGTATTTAGA
TTAAATTAGTCTATTATGGACTAAGACGAAGTAGACTAGTATACATTGCATGCCTTCGCT
CCTCAATAAAAGAGGCAAAGCATAACACAAGGGAAGAAGAGATAAATAGAGATTTTAGAT
ATATTTGGGTTTGAGGTGTTTGAGAATAACAGCTTTGAGTAATTGTGCATAAATTTTGCA
AATGAAAAGCTTTAATAACTTTATATTAGCTATATTTATGAGGGAGAAAGAAACATATTT
AAATAATAAGGATTAGAAAAATATTTAATGGAAATAAAGTATACTGATAATAAATCTATT
ATAGAGGCTCTTGACAAGCCTAAAGATCCTATTGGAGTTTTTAATTTAATTGATGATTCA
AGCAATTTAAGTACTGGAAGTGACTTAAATTTGATATCTCAAATGGAAAGGGAGCATAAA
TCAAATAGTTAGCATGTTTCCTTTTCTTAGATTTAAAAAACTAATTTTACTATTCACCAC
TCAACAGGGAGTATTGAATACAATATTACTAACTTTAGGGCAAAGAATAAGGATGAAGTC
TCATTAGCATTATAAAACTTAGCTTAATAAAAAACAATTAAGTCAATCATTTAGCTAGGA
ATTACAGATTTTAATACTTAATAAGTTGGGAGTAGAGTAACAGATAAATTTTTAGGTTCA
AAATTCAGACTTTAAATGAAAAAGTTAATGGAAGAATTAAGCTCTTGTGAGTGCCAATTT
GTAAGATGTATTAAACCTAATGCATCAAAAAAGGCAGGATTTATATAACCTAGATATTCT
CTGAATTAAATAAACTGTCTTGGTGTTTTAGAGACAATCCGTGTCAGGAAATAAGGGTAT
GTTTACAGAGCTGATTATTTTAGATTTTATAAAGACCACTGGGAGCTATATCCACCAAAT
TTCAATGAAATTAAAGCAGATGTAACTACTATGTTTTAAAAAATAACAGATTATTAAAGA
CTAAGTTAAAAATTAGTGGAGATGAATGTTGACCAAAAATAATTAGAATAAAATAATATT
TTATTTGGAAATAGCATGATTTTTATAAAAGAAAGTGCTTTAATGATCCTAACATCAAAG
CTGATACAAACAAAAGAAGAAATCAATCGCAATGTTAAATTAATACAGAAATTGTTTAGA
AATTACAAGCTTAAAAAATGGTTAAAAAACAGAAAGAAAGTTAAACAATTTTTGAAAGGA
TTAATTTATAGATTCAGATATTTAAAATCTGATGTTGTTGCAAAAATAAGAGGAATGAGG
AAAGCTAAGGAATTAGAAGCAAAGCAAAATATTTCTGCTAAGAAAATTTAAAAAATGATC
AGAAATTTTATCTTAAAGAAAAGAATGAAAGAAATCAGGGCAGCTTTGATGATATAACGT
GCATATATTATGTACAAAAAGAAAGAATATTACAAATAGAAACTTAAAGGTATCAAGGAG
TTTATAAAATCGAAATTTTTGATGTTAAAGGAAAGATCAATTTATAAAAAAAAGCTTAAA
AGTATCCTACAAATATAAAAGTGGTATAAAAAAAATTTACAATAGAGATAAATTGAAATG
TGCAAAAAAGTCATTATGGTAATTAGTTAATCGCTTGACAAGTCTTGGCTAAAAATCAGA
AATATTTCAGCTATTAAGATTCAATCCCTAGTTAGAATGTTCTTGGCTAAAATTAACAAC
TACGGTATTGTAAAACAATCAAGAGAAGCTAAAAATGTAATTCTAGAAAGAAAAGCTATC
TAAAAAATTTAAAGGTATTGGAGATATAGAAATTTTTATTTATCAATGAAAAGATATAGA
AACGCTGCTTACAGAATACAAGCCTATTTCAGAAAAAAGTGGTGCTCTGCTCTATTTCAG
CTTATCAAAAAGAATACTAAATTCATTTAGATGCATGTAAGGTCTTGGTTGAATTAAAAA
TATTTTCTAACTGAGAAATGGGTTAAATATGATTGGAATTCAGTTAAAAGAGATGAAATG
CTTAATTAGCAAAACTTGGTCATTCTTGGAATTCCTTATAAAAAAAATTTGGTGAAAAAC
TTAAAATTTTAAGAATTAAAAAATTAGTTTTATGAGTAGCACACTGTATTAAGCTTACAA
AGAGCCTAAAAAAAAATTGAGTATTTATAAAAAAAACAAAAGAACCTGGATAGATAAGAT
AGTTTAGCAAAATTAGCAGCTTTAAAATAAAAGATAAAATCTTAGAAAAGTATTGTTTTA
TCTTCAGCGAAGGTAAGTCAATAGCAATCTATTTAAGAATTCGAAGATTTAGGCTTAGAT
TAATAGTTAAAAATCCTAAAATCATCTATTAAGTTAGGAGGAGCAGAAAAGCAGGAGATA
TAAAAATAATCTCCAATTAATGAAATTAATATTAAGCTTGATGATTGTTTAAATGGTATT
GATTAAAATATCTTAATGTAAAATTAATTTGGCAAAATATAAATGTAAATAACCTTGAAA
GATAATGATCAATATTAGACTTAAGTAAATGAATTCACTTCAAATAATTAGCCTAAAATT
TAAGAGTATTACTATCATGATTTGGGTCTTGAAAAGGATCATATATTATATGATTTTAAT
TCAGAAAGCAGAAAAAAGCAAGTTTAAAGTTAGCTACAGGCAAAAAGAATGTCAGTTGAT
GTGATAAAGCTAAATACTATTTTACTTGATTTCGATTAATAACCATAATCACATGAAATT
TATACTTCTTAAATATGGGCACAGCATTACTAGGATATTCAGAGTGAACTTGAGTAATCA
AACTCTTCAATTTTAAAAATTTTTATTGGAGATTCTTATACTACAATAGTCGGAGATAAC
TCAGTCTGTTATACGTTTGGAGATGAGTTTTTAAATCATCAAGTTCACACAACAGATTAA
TAAATTTATTATAGTCCTGATAAGTTTTTAAATGATTAACCCTTATAATCTAAAATAAGT
TAATCATCTAATAGATATTAGTAATAAACCAAAAACACATCTAACATCTATGAAAGTCCA
AATCTACAAAGATAAATTCCTAATTACTAAGCACAATTATATTCTACTCCTCAAAAAAAA
TTATAAAATGATCTCATACCCTCTGTACTTTAAAATAATCCTCTATTTGTTTAATTAGAA
ACTTAAAACTATTAATAGAATAGTTAAAAAAAATTTTAAAGTAGCTATAGTCCATAAGAC
TAATACAATAACTCTTAGCAAAAATTAAAAATGAACTAAAATAATTCAAATAATAGCTTA
TATAATAGCTTGAGAAAGTAAGCTGGTCTTTTCTAAAACTAAGAACCACCTGAACAAATC
TCTACTTAAACTTTAAACACCTAAAATAATATTTCATATTAAACCGAAGAATAATTTAAT
CCACCTAAAAAGGTGATAAAATGCAAAATAGATAAAATAAATAGCATTTTCAAGGCTAAT
AATCAGCTGTTCATTCAAAATTAACTAAAGGATATGTATTGCTGGGGAGACAATAGTCAA
TTTGAAATACCCTTTTTTGAAGATATTTATTTGTATGAAATTTCTAAAATTGATCCTTAA
AAATCATAGTAAATTTCTTAAATAGATTAGCAAGCCATTTCTAATTAGTTTTTTTATTTG
TTAACTGATGGAGATGTTTTACACTATAATTATAAAAAATCTATTGACTTTGAAAGAATC
AGATTCCCTGTCTAAATATCTTAAATAAGCTGTGGAGGTCATTTTACTATGTTTTTGTCA
ATTTAGGGTACACTATTCTCTTCTGGCTAAAATACTTCAGGGGAATTAGGTCATGGTGAT
AGACTATTTAGAAAAAGTCCTTAACTTATAAGCTCATTTAAGAAATTTGGAGAAAAGATC
AAATAAGTATCTTGCGGGCTAAAGCATACAATATGTCTCACAGCATTAGGAAAGATTTTT
TCCTGGGGAAACAATAGATTTGGGTAACTAGGTGTAGGAGATACTAAATATAGATCAAAT
CCATAATTAATTTTTGTGAAAAGTAAATCTATAGACTCAATCAATTCATTTTTGCAAGTT
AGAGCTGGTTTAAGATCAAGCATAGTTTTAACAATTGACAAGCGTCTAGCGTGGTGGGGA
ACGAACTCATGTTTAGATCACTAAGTATTTCCAATTGAATTAAATTTACAAGATTATAAA
AATGATTTGAATTCTAAAGAATTGATACCTATTAAACTAATGAGTAGCTGGAGTAAAAAT
CTTAGCCTTTTTTATATTATTGTAGCTGATATTACATATTGTTATAGCTAAAACAAAAGT
GTAATCATTAAATCTCTACAGTCTCTTTCTTAGAAATGGGAAGACTAGCAAATTTTCCCT
AGTGCAGATAAAAACATAATGAAATACATACAAATAAAAGGGATGAGATAAACTAATATA
GAATAGTGA


>TTHERM_00059050(protein)
MMQFEEGAPVWYSLKEGLKNTSKQADAPAFVESVVISVIDKNKSLIQLLDQPSPSILSLL
NEKQANQAKPSNLQIQQGGNQNLIVVDNIFLEPRYDKEDGDYSSINDLVNLPFLNEPELL
KAIAQRYVQDKIFSYVGPTLVVVNPYKRMDHLFNEKTQELYQEKVIQNQDIYSEQPHIFG
IAAYCMQSILQEKTLKQAIVISGESGAGKTENTKYAMKFLTQMNAQFQQQNTPQTLTNLR
ESYLNLKSRQTLKSTVSIEQRILNCNPILEAFGNAKTTRNDNSSRFGKLVILHLKEDIGS
SFSIKQKQKKLVISSASLTNYLLEKSRIVQISQQERNYHIFYHLLKGAEPQFLSQLGLSP
DISSYRYLKSECSNVDTLSDEQLFLEVMSSLDDLNFTEIEQKGIWNIVSCVLLLGNLDFE
EVKTTGDSCTISPKQKQTVETICKKLQCTEKELNDALTTKKRQVNNNVTTSPLSIKESID
NRDSYSKFLYEKLFNWIVFRLNQSIMDQDEVDQYTLHAFAPQQKRQSITQGKKRQIEILD
IFGFEVFENNSFEQLCINFANEKLQQLYISYIYEGERNIFKQQGLEKYLMEIKYTDNKSI
IEALDKPKDPIGVFNLIDDSSNLSTGSDLNLISQMEREHKSNSQHVSFSQIQKTNFTIHH
STGSIEYNITNFRAKNKDEVSLALQNLAQQKTIKSIIQLGITDFNTQQVGSRVTDKFLGS
KFRLQMKKLMEELSSCECQFVRCIKPNASKKAGFIQPRYSLNQINCLGVLETIRVRKQGY
VYRADYFRFYKDHWELYPPNFNEIKADVTTMFQKITDYQRLSQKLVEMNVDQKQLEQNNI
LFGNSMIFIKESALMILTSKLIQTKEEINRNVKLIQKLFRNYKLKKWLKNRKKVKQFLKG
LIYRFRYLKSDVVAKIRGMRKAKELEAKQNISAKKIQKMIRNFILKKRMKEIRAALMIQR
AYIMYKKKEYYKQKLKGIKEFIKSKFLMLKERSIYKKKLKSILQIQKWYKKNLQQRQIEM
CKKVIMVISQSLDKSWLKIRNISAIKIQSLVRMFLAKINNYGIVKQSREAKNVILERKAI
QKIQRYWRYRNFYLSMKRYRNAAYRIQAYFRKKWCSALFQLIKKNTKFIQMHVRSWLNQK
YFLTEKWVKYDWNSVKRDEMLNQQNLVILGIPYKKNLVKNLKFQELKNQFYEQHTVLSLQ
RAQKKIEYLQKKQKNLDRQDSLAKLAALKQKIKSQKSIVLSSAKVSQQQSIQEFEDLGLD
QQLKILKSSIKLGGAEKQEIQKQSPINEINIKLDDCLNGIDQNILMQNQFGKIQMQITLK
DNDQYQTQVNEFTSNNQPKIQEYYYHDLGLEKDHILYDFNSESRKKQVQSQLQAKRMSVD
VIKLNTILLDFDQQPQSHEIYTSQIWAQHYQDIQSELEQSNSSILKIFIGDSYTTIVGDN
SVCYTFGDEFLNHQVHTTDQQIYYSPDKFLNDQPLQSKISQSSNRYQQQTKNTSNIYESP
NLQRQIPNYQAQLYSTPQKKLQNDLIPSVLQNNPLFVQLETQNYQQNSQKKFQSSYSPQD
QYNNSQQKLKMNQNNSNNSLYNSLRKQAGLFQNQEPPEQISTQTLNTQNNISYQTEEQFN
PPKKVIKCKIDKINSIFKANNQLFIQNQLKDMYCWGDNSQFEIPFFEDIYLYEISKIDPQ
KSQQISQIDQQAISNQFFYLLTDGDVLHYNYKKSIDFERIRFPVQISQISCGGHFTMFLS
IQGTLFSSGQNTSGELGHGDRLFRKSPQLISSFKKFGEKIKQVSCGLKHTICLTALGKIF
SWGNNRFGQLGVGDTKYRSNPQLIFVKSKSIDSINSFLQVRAGLRSSIVLTIDKRLAWWG
TNSCLDHQVFPIELNLQDYKNDLNSKELIPIKLMSSWSKNLSLFYIIVADITYCYSQNKS
VIIKSLQSLSQKWEDQQIFPSADKNIMKYIQIKGMRQTNIEQ


>TTHERM_00059050(gene)
ATGATGCAATTTGAGGAAGGAGCACCAGTTTGGTATTCTCTTAAAGAAGGTCTGAAGAAT
ACTTCAAAATAAGCTGATGCACCTGCTTTCGTAGAATCAGTAGTCATTTCTGTAATTGAT
AAAAATAAATCTTTAATATAATTGCTAGATTAGCCCAGCCCTTCAATACTAAGCTTGCTT
AATGAGAAACAAGCTAACTAGGCAAAGCCTTCTAATTTATAAATTCAATAAGGTGGAAAT
TAAAACTTAATTGTTGTTGATAATATTTTTTTGGAACCTAGATATGATAAAGAGGATGGA
GATTATTCTTCAATAAATGATTTAGTTAACCTTCCTTTTTTAAATGAACCTGAATTGCTT
AAAGCAATAGCTCAAAGATATGTTTAGGATAAAATATTTAGCTATGTTGGTCCTACTCTT
GTTGTAGTAAATCCTTATAAAAGAATGGATCATCTATTTAATGAAAAAACACAAGAATTG
TACTAAGAGAAAGTTATTTAAAATTAAGATATTTACTCTGAATAGCCTCACATATTTGGA
ATAGCTGCTTATTGTATGCAAAGTATTTTGTAAGAAAAAACACTTAAATAAGCGATTGTA
ATATCAGGAGAGTCTGGTGCAGGTAAGACTGAAAATACAAAATATGCTATGAAATTTTTA
ACCCAAATGAATGCTTAATTTTAATAGTAAAATACACCTTAAACTTTGACTAATTTGAGA
GAAAGCTACTTAAACTTAAAATCTAGATAAACTCTAAAATCAACTGTCTCTATAGAATAA
AGAATATTAAACTGCAATCCAATTTTAGAAGCTTTTGGTAATGCTAAAACAACAAGAAAT
GATAATTCATCTAGATTTGGAAAATTAGTTATCTTGCATTTAAAGGAAGATATTGGTTCT
TCATTTTCAATCAAGTAAAAGTAAAAAAAACTAGTAATTTCGTCTGCTTCTCTTACAAAC
TACTTGCTAGAAAAAAGCAGGATAGTTTAAATTTCGCAATAAGAAAGGAATTATCATATT
TTTTATCATCTTCTAAAAGGAGCTGAGCCTCAATTTCTTTCTCAATTAGGATTGAGTCCA
GATATTTCTTCTTATAGGTAACAAAAAAGTATTATTTTAAATTAGCTCATACTTATTATT
TTTGAACTTCAAAAAGGTATTTAAAAAGTGAGTGCAGTAATGTTGATACTTTATCTGATG
AATAGCTGTTTTTAGAAGTTATGTCAAGTTTAGATGATTTGAATTTTACTGAAATAGAAT
AAAAGGGAATTTGGAATATAGTTAGCTGTGTCCTTTTGTTAGGAAATCTAGATTTTGAAG
AAGTTAAAACAACAGGCGATTCTTGCACTATTTCGCCTAAATAGAAATAAACAGTAGAAA
CTATATGTAAAAAGCTTTAGTGTACTGAAAAAGAATTAAATGACGCTTTAACAACTAAAA
AAAGATAAGTTAACAACAATGTTACAACTTCTCCTCTTTCTATCAAAGAGTCAATAGATA
ATAGAGACTCTTACAGTAAATTTTTATATGAAAAGCTATTCAATTGGATAGTATTTAGAT
TAAATTAGTCTATTATGGACTAAGACGAAGTAGACTAGTATACATTGCATGCCTTCGCTC
CTCAATAAAAGAGGCAAAGCATAACAGTAAACAATTTTATTATTAATTAATTAAATCGTT
AAAAATAAATAAAAAATTGAAGGAGATATCTTAAGTCTTTAAAAAATGTTTGTTTGTTTT
AAAAGCAGATTAATATTAAATAAGTATTTTCTTGTTTTTGGATAAGAGACTTTGCTCTAT
TTATGAATTTTATTAATAATTATTTTAATTTTAATAAAGCAAGGGAAGAAGAGATAAATA
GAGATTTTAGATATATTTGGGTTTGAGGTGTTTGAGAATAACAGCTTTGAGTAATTGTGC
ATAAATTTTGCAAATGAAAAGCTTTAATAACTTTATATTAGCTATATTTATGAGGGAGAA
AGAAACATATTTAAATAATAAGGATTAGAAAAATATTTAATGGAAATAAAGTATACTGAT
AATAAATCTATTATAGAGGCTCTTGACAAGCCTAAAGATCCTATTGGAGTTTTTAATTTA
ATTGATGATTCAAGCAATTTAAGTACTGGAAGTGACTTAAATTTGATATCTCAAATGGAA
AGGGAGCATAAATCAAATAGTTAGCATGTTTCCTTTTCTTAGATTTAAAAAACTAATTTT
ACTATTCACCACTCAACAGGGAGTATTGAATACAATATTACTAACTTTAGGGCAAAGAAT
AAGGATGAAGTCTCATTAGCATTATAAAACTTAGCTTAATAAAAAACAATTAAGTCAATC
ATTTAGCTAGGAATTACAGATTTTAATACTTAATAAGTTGGGAGTAGAGTAACAGATAAA
TTTTTAGGTTCAAAATTCAGACTTTAAATGAAAAAGTTAATGGAAGAATTAAGCTCTTGT
GAGTGCCAATTTGTAAGATGTATTAAACCTAATGCATCAAAAAAGGCAGGATTTATATAA
CCTAGATATTCTCTGAATTAAATAAACTGTCTTGGTGTTTTAGAGACAATCCGTGTCAGG
AAATAAGGGTATGTTTACAGAGCTGATTATTTTAGATTTTATAAAGACCACTGGGAGCTA
TATCCACCAAATTTCAATGAAATTAAAGCAGATGTAACTACTATGTTTTAAAAAATAACA
GATTATTAAAGACTAAGTTAAAAGTAATATTTACTTTAGAATTTCAAGAATCACTTTTTA
ATAGAGTTTTACATCAAATATTAGATTAGTGGAGATGAATGTTGACCAAAAATAATTAGA
ATAAAATAATATTTTATTTGGAAATAGCATGATTTTTATAAAAGAAAGTGCTTTAATGAT
CCTAACATCAAAGCTGATACAAACAGTAAAAATAAATAATTTTAATAAAATCATAAATTT
ATTTATTTAATTAATATTAGAAAGAAGAAATCAATCGCAATGTTAAATTAATACAGAAAT
TGTTTAGAAATTACAAGCTTAAAAAATGGTTAAAAAACAGAAAGAAAGTTAAACAATTTT
TGAAAGGATTAATTTATAGATTCAGATATTTAAAATCTGATGTTGTTGCAAAAATAAGAG
GAATGAGGAAAGCTAAGGAATTAGAAGCAAAGCAAAATATTTCTGCTAAGAAAATTTAAA
AAATGATCAGAAATTTTATCTTAAAGAAAAGAATGAAAGAAATCAGGGCAGCTTTGATGA
TATAACGTGCATATATTATGTACAAAAAGAAAGAATATTACAAATAGAAACTTAAAGGTA
TCAAGGAGTTTATAAAATCGAAATTTTTGATGTTAAAGGAAAGATCAATTTATAAAAAAA
AGCTTAAAAGTATCCTACAAATATAAAAGTGGTATAAAAAAAATTTACAATAGAGATAAA
TTGAAATGTGCAAAAAAGTCATTATGGTAATTAGTTAATCGCTTGACAAGTCTTGGCTAA
AAATCAGAAATATTTCAGCTATTAAGATTCAATCCCTAGTTAGAATGTTCTTGGCTAAAA
TTAACAACTACGGTATTGTAAAACAATCAAGAGAAGCTAAAAATGTAATTCTAGAAAGAA
AAGCTATCTAAAAAATTTAAAGGTATTGGAGATATAGAAATTTTTATTTATCAATGAAAA
GATATAGAAACGCTGCTTACAGAATACAAGCCTATTTCAGAAAAAAGTGGTGCTCTGCTC
TATTTCAGCTTATCAAAAAGAATACTAAATTCATTTAGATGCATGTAAAATAAATTTACT
TTAACAGAATATTTAGTTATTATTTAAATTAAAAACCTTTTTTCTCTCATATTGTTTTAT
TCAAATATTATTTCAATCTATTTTTTTAGTTTAAAATTTTATGAGATTTTATTTTTCATA
AATAATTTCTAAAGGTAAGGTCTTGGTTGAATTAAAAATATTTTCTAACTGAGAAATGGG
TTAAATATGATTGGAATTCAGTTAAAAGAGATGAAATGCTTAATTAGCAAAACTTGGTCA
TTCTTGGAATTCCTTATAAAAAAAATTTGGTGAAAAACTTAAAATTTTAAGAATTAAAAA
ATTAGTTTTATGAGTAGCACACTGTATTAAGCTTACAAAGAGCCTAAAAAAAAATTGAGT
ATTTATAAAAAAAACAAAAGAACCTGGATAGATAAGATAGTTTAGCAAAATTAGCAGCTT
TAAAATAAAAGATAAAATCTTAGAAAAGTATTGTTTTATCTTCAGCGAAGGTAAGTCAAT
AGCAATCTATTTAAGAATTCGAAGATTTAGGCTTAGATTAATAGTTAAAAATCCTAAAAT
CATCTATTAAGTTAGGAGGAGCAGAAAAGCAGGAGATATAAAAATAATCTCCAATTAATG
AAATTAATATTAAGCTTGATGATTGTTTAAATGGTATTGATTAAAATATCTTAATGTAAA
ATTAATTTGGCAAAATATAAATGTAAATAACCTTGAAAGATAATGATCAATATTAGACTT
AAGTAAATGAATTCACTTCAAATAATTAGCCTAAAATTTAAGAGTATTACTATCATGATT
TGGGTCTTGAAAAGGATCATATATTATATGATTTTAATTCAGAAAGCAGAAAAAAGCAAG
TTTAAAGTTAGCTACAGGCAAAAAGAATGTCAGTTGATGTGATAAAGCTAAATACTATTT
TACTTGATTTCGATTAATAACCATAATCACATGAAATTTATACTTCTTAAATATGGGCAC
AGCATTACTAGGATATTCAGAGTGAACTTGAGTAATCAAACTCTTCAATTTTAAAAATTT
TTATTGGAGATTCTTATACTACAATAGTCGGAGATAACTCAGTCTGTTATACGTTTGGAG
ATGAGTTTTTAAATCATCAAGTTCACACAACAGATTAATAAATTTATTATAGTCCTGATA
AGTTTTTAAATGATTAACCCTTATAATCTAAAATAAGTTAATCATCTAATAGATATTAGT
AATAAACCAAAAACACATCTAACATCTATGAAAGTCCAAATCTACAAAGATAAATTCCTA
ATTACTAAGCACAATTATATTCTACTCCTCAAAAAAAATTATAAAATGATCTCATACCCT
CTGTACTTTAAAATAATCCTCTATTTGTTTAATTAGAAACTTAAAACTATTAATAGAATA
GTTAAAAAAAATTTTAAAGTAGCTATAGTCCATAAGACTAATACAATAACTCTTAGCAAA
AATTAAAAATGAACTAAAATAATTCAAATAATAGCTTATATAATAGCTTGAGAAAGTAAG
CTGGTCTTTTCTAAAACTAAGAACCACCTGAACAAATCTCTACTTAAACTTTAAACACCT
AAAATAATATTTCATATTAAACCGAAGAATAATTTAATCCACCTAAAAAGGTGATAAAAT
GCAAAATAGATAAAATAAATAGCATTTTCAAGGCTAATAATCAGCTGTTCATTCAAAATT
AACTAAAGGATATGTATTGCTGGGGAGACAATAGTCAATTTGAAATACCCTTTTTTGAAG
ATATTTATTTGTATGAAATTTCTAAAATTGATCCTTAAAAATCATAGTAAATTTCTTAAA
TAGATTAGCAAGCCATTTCTAATTAGTTTTTTTATTTGTTAACTGATGGAGATGTTTTAC
ACTATAATTATAAAAAATCTATTGACTTTGAAAGAATCAGATTCCCTGTCTAAATATCTT
AAATAAGCTGTGGAGGTCATTTTACTATGTTTTTGTCAATTTAGGGTACACTATTCTCTT
CTGGCTAAAATACTTCAGGGGAATTAGGTCATGGTGATAGACTATTTAGAAAAAGTCCTT
AACTTATAAGCTCATTTAAGAAATTTGGAGAAAAGATCAAATAAGTATCTTGCGGGCTAA
AGCATACAATATGTCTCACAGCATTAGGTATTTATTAAATTATATCGTTTAAAAAAAACA
TCATATATCTTACATTTATTTTTTAATATCAGGAAAGATTTTTTCCTGGGGAAACAATAG
ATTTGGGTAACTAGGTGTAGGAGATACTAAATATAGATCAAATCCATAATTAATTTTTGT
GAAAAGTAAATCTATAGACTCAATCAATTCATTTTTGCAAGTTAGAGCTGGTTTAAGATC
AAGCATAGTTTTAACAATTGACAAGCGTCTAGCGTGGTGGGGAACGAACTCATGTTTAGA
TCACTAAGTATTTCCAATTGAATTAAATTTACAAGATTATAAAAATGTAATTTGTTAATT
TTTGATTATTAATTACAAAATTAATTTATAAAATTTGAAAATTAAATTAAGGATTTGAAT
TCTAAAGAATTGATACCTATTAAACTAATGAGTAGCTGGAGTAAAAATCTTAGCCTTTTT
TATATTATTGTAGCTGATATTACATATTGTTATAGCTAAAACAAAAGTGTAATCATTAAA
TCTCTACAGTCTCTTTCTTAGAAATGGGAAGACTAGCAAAGTAATTAAAAAATTGTTTTT
CAATTTAACTAAATTTTTTTAATAATATAATTTATTGTAGTTTTCCCTAGTGCAGATAAA
AACATAATGAAATACATACAAATAAAAGGGATGAGATAAACTAATATAGAATAGTGA