Identifiers and Description

Gene Model Identifier

TTHERM_00112430

Standard Name

MYO1 (MYOsin)

Aliases

PreTt27057 | 8.m00317 | 3812.m02353

Description

Myosin heavy chain; molecular motor involved in phagocytosis and macronuclear elongation; has putative ATP-binding and phosphorylation sites; member of proposed Class XX, distinct from previously defined myosin classes, putative

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00112430

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03972.19.997093137033517e-262myosin (1836 aa)
OxytrichaContig18292.0.g1082.9998177333176706e-124Myosin head (motor domain)
DictyBaseDDB_G02886791.9992982665753866e-121myoE on chromosome: 5 position
1829072 to 1832587
WormBaseWBGene000020381.0002857351297358e-115locus:hum-5 status:Confirmed
UniProt:G5ECZ0 protein_id
:CAA84673.1
SGDYAL029C1.0001900614163146e-108MYO4 One of two type V myosin
motors (along with MYO2) invol
ved in actin-based transport o
f cargos; required for mRNA tr
ansport, including ASH1 mRNA,
and facilitating the growth an
d movement of ER tubules into
the growing bud along with She
3p

General Information

Paragraph NoGene NameParagraph Text
10MYO1,
MYO12,
MYO11,
MYO10,
MYO9,
MYO4 ,
MYO5,
MYO4,
MYO3,
MYO2,
MYO13
Proteins of the myosin superfamily are ATP-dependent molecular motors that travel unidirectionally along actin filaments. The myosin heavy chain proteins are comprised of three domains: a head (motor) domain responsible for ATP hydrolysis at the N-terminus, a neck (lever arm) region, and a C-terminal tail region. Thirteen predicted myosin heavy chain genes have been identified in the Tetrahymena genome and named MYO1-MYO13. A phylogenetic analysis comparing these predicted proteins with the 19 previously identified myosin classes suggests that Myo1p-Myo12p belong to a previously undescribed class of myosins. This new family, designated Class XX, does not include Myo13p, which did not branch with this class or any of the other classes in the analysis. The neck and tail regions of the Tetrahymena myosins include a variety of domains characterized in other myosin classes, with each protein containing one or more of the following domains: coiled-coil (which may support dimerization); IQ motif (binding sites for calmodulin or calmodulin-like proteins); FERM domain (Four-point-one protein, Ezrin, Radixin, Moesin homology); and MyTH4 domain (Myosin Tail Homology 4).

Associated Literature

  1. Ref:17688250: Hosein RE, Gavin RH (2007) Myo1 localizes to phagosomes, some of which traffic to the nucleus in a Myo1-dependent manner in Tetrahymena thermophila. Cell motility and the cytoskeleton 64(12):926-35
  2. Ref:16505385: Foth BJ, Goedecke MC, Soldati D (2006) New insights into myosin evolution and classification. Proceedings of the National Academy of Sciences of the United States of America 103(10):3681-6
  3. Ref:15810016: Hosein RE, Williams SA, Gavin RH (2005) Directed motility of phagosomes in Tetrahymena thermophila requires actin and Myo1p, a novel unconventional myosin. Cell motility and the cytoskeleton 61(1):49-60
  4. Ref:15988740: Williams SA, Gavin RH (2005) Myosin genes in Tetrahymena. Cell motility and the cytoskeleton 61(4):237-43
  5. Ref:11128708: Williams SA, Hosein RE, Garcés JA, Gavin RH (2000) MYO1, a novel, unconventional myosin gene affects endocytosis and macronuclear elongation in Tetrahymena thermophila. The Journal of eukaryotic microbiology 47(6):561-8
  6. Ref:9627986: Garcés J, Gavin RH (1998) A PCR screen identifies a novel, unconventional myosin heavy chain gene (MYO1) in Tetrahymena thermophila. The Journal of eukaryotic microbiology 45(3):252-9

Sequences

>TTHERM_00112430(coding)
ATGAATAAAAGTTATTAAGAATGGATTAATCCTAATGTAGAGTGTTGGGTTTGGCTCAAA
TATGAAAATTCTTAGCAAAATTAAAACAATTCTGAAAATGGATAATATTTCTAGTGCGTT
ATTCAATCAGTATAAAAAGAAAAGAATTTAGCAAAGATAAAAGTTACTTGTAAAGAAGAA
TAATTAGGAAATCGAATATCAGATTAAGCAATTAATGGATAATTAGATGTTTAATTTGAA
AGATTATTAGAAAAGGAAATTATGGTTGATTCTCTTCAAACTTTAGGTTATTCAGATATG
GTTCATATGAAGTATTTAAATGAGGCTGAAATAATCAATAATTTGAGAAAGCGATATTAA
AATAATATGATTTTCACATATATTGGACCAACTTTGGTAGTTATGAATCCATATAAAGAA
ATAGAAGGAGTATAAGATAATCAAGTAATAGATAAAATAAAATCTGATCTAGGCATAAAA
TTTGAAGAGGATTTCAAAATGAATAATCTGAGCACCAACTAAAATATTATAAACACACCT
CATACATATACTGTAAGCGGATTAGCCTACAAATAAATGTTTAGCAATAAGAAAAATTAA
GCAATAGTTATATCAGGCGAAAGTGGAGCAGGTAAAACAGAAAATGCTAAATTATCGATG
CAATTTTTAACAAGTTTGAGTTCAGGGTCTGATAAATAAAATGATTTACTCAATTAATTA
AAGACTCAAACAGCTAAGAATATTCTATTAGAAGAGTTTAACTAATTTGCAATAGAAGTA
AAAATACTTGCTTGTAATCCTATTCTAGAAGCTTTTGGTAATGCTAAAACAGTAAGAAAT
AATAATTCCTCTAGATTTGGTAAATACGTAAAAATCTACATAGATAAAACATCTTAAAAG
ATAAATGGAGCCTCCATTGATAGCTACTTACTCGAAAAGAGCAGAATACCTTGTCCAGGA
AAGGGAGAGAGAAATTATCACATTTTTTACCACATGCTAAAAGGAAATCAAGAACTATCT
AATTTGAGATTGAGTTAGTTCAAAAATTTATCTGATTTTGATTATCTAAAGAAAAGTGAC
TGCTTTGAGGTTGAGAACATTTAAGATGCTAAACTCTATTTGGAAGTAAAGAAGTCCTTC
AGATAAATGAATTTCTCTAACTAAGAGTAAGAAGCTATATTTTCTCTAATATCTGCGATA
CTACTGTTAGGCAATGCAAATTTAGACTCATCAAAAGCTAGCGACACTCAGGCTCCAACT
TTTTTGAACATGAGTTTACCGACACATCATAAAGAATTCAAAAATGCCTCTGAGTTACTC
TAAGTTAATCCTAAAGACCTTGAAGAGTCTTTAGTATTTAAGGTAAGGAAAGTTGGAACT
ACAGTAATTAAATCTCCATAAACTGCTGAAGAATGCTTGTCTATGAGAGACAGTCTAAGT
AAAAATCTATATGATAGTCTTTTTAACTTTTTGGTTTGGAAGTTAAATTAAAATTTGTTG
CCACCTTAAGATTTGCTAAATAAATCATTAAGCATAGGCCTTTTAGATATATTTGGTTTT
GAGAGCTTTGATATAAACTCATTTGAGCAGCTTTGCATTAATTTTACCAATGAAAAATTT
TAGTAATTGTATGTTTAATATGTTTTCAAAAGCGAAGAAGAAGATTATAAATAAGAAGGA
ATTTTGGATGTATTTTCTGATTTATAATATTAAGAGAATTAGCTCATTATTGATACAATT
GAAAAAAAACCCAATGGAATCATGGTGCTTTTAGATGAAAATTGCTCATTGGGATCAGGG
ACGGATGATTCTTTTTTAAATTAAATTACAAAAAACCACTCTAAAAATCAACTTGTCAGC
TTCCCTAAAAAAGATAAATATTCTTTCAGCCTTAGTCATACAGCAAAACAAGTTGTATAT
GATGTGCGCGGATTTAGAGATAAAAATAAAGATGAAGTGAGTACCGAAGTAGAAAAATGT
CTTTAAAGTAGTAAATGTCCAGTTATTGCGAATTTATTATCTTATTAAGGGTCTTAAACT
TAGTAGAATAAAGAAACTTAAAATCTTCAAAATTTTGGAAATAATTTAAATTTTAAAAAA
GCTGAAATTAGTAATCAAATGAACTCAAGTAAAAAGAATGTAAAGTTTCTAGGCTAAAAA
TTTAGATAATCTTTATAGGAATTAATGATAGAATTGAATAATAGCGATGTTCACTTCATA
AGATGTATAAAACCAAACGAAGAAAAGAAAAAGAATTTTTTTAAGTATGATTATGTTTAT
TAGCAAGTACAGTATTTAGGCATACTTGATTCCATTAAAATCCGCAAAGTTGGATATTCT
TACAGAATGACTTATGAAAACTTTTTCTTAGAATACCAAGAACTGGGATAGAAAACAAAA
GGATTAACATTGTAGAAGGTTTAGCAATAAAAGTTAGATTTAAAATAATTAATTACAACA
GAAATATTTGAAAAGACCAATTTATTGCAAAATAAATAACTTCCTTAGAAATGTGTAGCA
TTTGGAAAAACAAAAATATTTCTCAAAAATGAAGTTATGAAGATTTTGCATGAAAAAATT
TAAGAAATTATTTAATAAAGAAAAAAATATGCAAAGCGAATTATTGTCTCAATTTAAAAA
TATCTGTTTAGGAAATACTTCCATAAGAATTTAATGAAAATAAAAAATTAATTAATTAAA
TTGCAATCATTTGCTAGAATGGCTATTTAAAGATAAAAATTCCTAAGGAAAAAGAAATCA
ATATTAAAAATGAAGAAGCTTATTAGGCTAAGAATGTTGGGATAAGGAATCTCTGCATTT
AGGTTAAACTATATCTCATTTGTGTGGGATTTGGTTTGTTTTATGATATTTGATAAAACA
AATATTCATATTGCATTTTAGTAAATTAAATATTATCGTAACCCAAATAAAACTAAGCCT
GTTGTTCAAAATTAAACATCTACAATTTAGTAAAATAAATAGTAAAATCAACAACCTTAA
AAAAGCCAAAATTAAGTTACTTCATCATTTTAAGTAAATAATTAAATGATGCAATAAAAA
TAAAGTCTTGTAGGCCAATAAATTTAATCTATTGTAAACGAGCTTAATTTAGGTGAGATA
TAAATTAATAAAACCTAACAAGATTTAAAAGACTTTAGAAAATCAAAGATTATACCTTAA
GTTAACTTGAATCCATCACATAGTAGTAAGAGGGCCAGCAATGCTTGGAGATAAACCCTA
ATTGCAAGTAGTAGTTAAAATAAAATTAATAAAGATTTGTAGCTATCTGAATTAGGAGAG
TAGAAGCTGATAAATATGAAAGAAACAACTGACTAAAAAGAAAAAATTAAATATACTAAA
CCTCTGATATTATAATTTACAGAGTATAACCCTGCTTATTAGTATGCAGAGTTTAATATG
GAGAGTGCAATAGATTTAGAAGATGTTCCTAATAGTTTAGATTTTGAGGGTGAATTAAAT
GATTTGATAAGTGAAGAAATCATTCAATAAATAAAAAAAAATAACTTTTATTCACACCTT
TCTTTTATTCTTGCAAAAAGAACAAAATGGGGAATCACACAAACTTAAGAGAAAATAATG
AGGCACTAGCTTAAACCAATTTCAAATCCACTAACAAATATTGCTGATTTGAAGAATATA
ATCACCTATGAAGACACAAAAGATGCTGTTTAATCAATTAGGAGTATTATTCAATAAAAT
AATTTATATAATGACACATCAACATAGACTTAAAGACCAATTAATTATGAAGATGCTAGA
ACTGGAAAATTAGATAAGTAAGTATCTAAATAAATTACTAACGATTAATCACAAAAATTA
GCAACTGTCTTTTCGAAATATTCTCTGATGAACCCAAGAAAAGCTAGTGTTAGAGACACA
AACTCACTTGAACAAATTGTCCTATAATAAAGAAAACTTACAAAATTAATTTAGTATAAA
AAATTTTCTCCTTCAGAAAAAGCTATTAACATATTTAAAACTCTCTTAAAGTGCACAGGA
GAAAGAAAATCCCGATATAACAGACACAACAATATCATAAAGCTTCTTACCCTTTGTAAC
GAAGAGTCAATCGACCTAAAAGAAGAAGTTTACGTTTAATTATGCAAATAATTAAGTGCA
AATGATAAAAAGGAGTCAAGAATAAAATATTTAAAGCTGTTTGCTATTATAAGCAGCATA
CTGCCAACAACCAGTAGATTTTATTATCCTTTACTTCACTTTTTATATATGAGAAATACA
GATACTCAAATAGAATAGGATGAGAGAAAATGGTACTAATACTGTTTTCAAAGAATTTAT
AAAAGTGAGTAAATACAAAGAGGATGCATCCCAACTGATACTGAAATTGTAATGATTGAG
AATAAGAAACAAATTTTGATTAGAGTTTATCTTCTAAATGAAATCCCAATTACTGTAGGA
GTAGAAAGCTATACTAGTGTGAAGATGCTTAAGCAGGAGCTACTTTAGAAAATAGGTATA
ACCTAAAGACATGAATATTATGGCCTTATGGAAGTAAGAAACAATATTAAGAAAAAGAGA
AAAGAAACGAGATTTATAGATGAAAGTGAGAGAGTAATGGATGTGATAGCTTTTTGGGAA
AATGAGTAGTATTTATTTGGATCTCAATTAAATTCTTCTTTCATACATAGCAACTCAAAA
TAAAATGATGAAGGTATTGAGCAATTCAACCTTTAAAATTATTAGGATCTTGAAGGACTT
AAAATTTACCTTGGAATCAGAATACTTTTTTCATTTTAAGAAAACGATAAAGAAGCAATA
AGCGTTTTCTACACTTAGCTATCTTCAGAAGTACTTGAAGGAAAGTATGCACCTTTGGAG
GAAAAAGATTACTTGAATTTGGCTGCTTTATAACTGTGCATAGATTTTCCAAGAGACGTC
ATTTTAAAAGAAATATCTAAAAGATAGAGTATCAATGCAGATAGTGGGTCTCCATAAAGA
ACATAGAGTAATTTTTTGAGTGCTACTAGCTAAAGTGAAAGCGGTGCATCACAGCTTAAA
AAGCTTTCTTATTAAGATATTGAACAGATTGATGAATAAGATGAATACGAACAATTCATA
TAAAATAGAAATGAAATTTTAATTGATCCGGTTTTTTACATACCAGCTAAAATGTATTTC
TAAAAAGATATTCAGTAATGGTAACACTTAATACTATAGAATTTGGTTGATAATAGACTT
TTAAAGAAAGAGTACACTCCATCTTAAGCAAAGTTAGCCTACATACTTTATCTTAGTAAG
TAAGATTTGTTTATGAGTACAATATTTAGAGATGTAAAATACCAAAGAATCAAAATTAAA
ACACTAAATGACACACTTTCTTCTAAAGAAAAATATGAGCAAATGATTTAATAAAATTAA
CAAATTCCCATTAAAGACGAGATACTTTTAGCAATAAACCCATCTAATATTCTGATGTGC
GATTCTATAGGTTTAAATAGACCAAAAAGAAGAGTGCAAATTAAAAATATCTAAAAATTT
TGCTGCACTGAGAAGGAAGTTATAGTAATATCTCATGATAATACAAAACATATTTTTGAA
ACTCCCCAATACTGTAGAGAAATAGCTTTCTTAATTCGCTCTTACTTGAGAATATTTTAT
TAAAAATAATAGTAACAACAATAATAAGAAAAAAGTCAATGA


>TTHERM_00112430(protein)
MNKSYQEWINPNVECWVWLKYENSQQNQNNSENGQYFQCVIQSVQKEKNLAKIKVTCKEE
QLGNRISDQAINGQLDVQFERLLEKEIMVDSLQTLGYSDMVHMKYLNEAEIINNLRKRYQ
NNMIFTYIGPTLVVMNPYKEIEGVQDNQVIDKIKSDLGIKFEEDFKMNNLSTNQNIINTP
HTYTVSGLAYKQMFSNKKNQAIVISGESGAGKTENAKLSMQFLTSLSSGSDKQNDLLNQL
KTQTAKNILLEEFNQFAIEVKILACNPILEAFGNAKTVRNNNSSRFGKYVKIYIDKTSQK
INGASIDSYLLEKSRIPCPGKGERNYHIFYHMLKGNQELSNLRLSQFKNLSDFDYLKKSD
CFEVENIQDAKLYLEVKKSFRQMNFSNQEQEAIFSLISAILLLGNANLDSSKASDTQAPT
FLNMSLPTHHKEFKNASELLQVNPKDLEESLVFKVRKVGTTVIKSPQTAEECLSMRDSLS
KNLYDSLFNFLVWKLNQNLLPPQDLLNKSLSIGLLDIFGFESFDINSFEQLCINFTNEKF
QQLYVQYVFKSEEEDYKQEGILDVFSDLQYQENQLIIDTIEKKPNGIMVLLDENCSLGSG
TDDSFLNQITKNHSKNQLVSFPKKDKYSFSLSHTAKQVVYDVRGFRDKNKDEVSTEVEKC
LQSSKCPVIANLLSYQGSQTQQNKETQNLQNFGNNLNFKKAEISNQMNSSKKNVKFLGQK
FRQSLQELMIELNNSDVHFIRCIKPNEEKKKNFFKYDYVYQQVQYLGILDSIKIRKVGYS
YRMTYENFFLEYQELGQKTKGLTLQKVQQQKLDLKQLITTEIFEKTNLLQNKQLPQKCVA
FGKTKIFLKNEVMKILHEKIQEIIQQRKKYAKRIIVSIQKYLFRKYFHKNLMKIKNQLIK
LQSFARMAIQRQKFLRKKKSILKMKKLIRLRMLGQGISAFRLNYISFVWDLVCFMIFDKT
NIHIAFQQIKYYRNPNKTKPVVQNQTSTIQQNKQQNQQPQKSQNQVTSSFQVNNQMMQQK
QSLVGQQIQSIVNELNLGEIQINKTQQDLKDFRKSKIIPQVNLNPSHSSKRASNAWRQTL
IASSSQNKINKDLQLSELGEQKLINMKETTDQKEKIKYTKPLILQFTEYNPAYQYAEFNM
ESAIDLEDVPNSLDFEGELNDLISEEIIQQIKKNNFYSHLSFILAKRTKWGITQTQEKIM
RHQLKPISNPLTNIADLKNIITYEDTKDAVQSIRSIIQQNNLYNDTSTQTQRPINYEDAR
TGKLDKQVSKQITNDQSQKLATVFSKYSLMNPRKASVRDTNSLEQIVLQQRKLTKLIQYK
KFSPSEKAINIFKTLLKCTGERKSRYNRHNNIIKLLTLCNEESIDLKEEVYVQLCKQLSA
NDKKESRIKYLKLFAIISSILPTTSRFYYPLLHFLYMRNTDTQIEQDERKWYQYCFQRIY
KSEQIQRGCIPTDTEIVMIENKKQILIRVYLLNEIPITVGVESYTSVKMLKQELLQKIGI
TQRHEYYGLMEVRNNIKKKRKETRFIDESERVMDVIAFWENEQYLFGSQLNSSFIHSNSK
QNDEGIEQFNLQNYQDLEGLKIYLGIRILFSFQENDKEAISVFYTQLSSEVLEGKYAPLE
EKDYLNLAALQLCIDFPRDVILKEISKRQSINADSGSPQRTQSNFLSATSQSESGASQLK
KLSYQDIEQIDEQDEYEQFIQNRNEILIDPVFYIPAKMYFQKDIQQWQHLILQNLVDNRL
LKKEYTPSQAKLAYILYLSKQDLFMSTIFRDVKYQRIKIKTLNDTLSSKEKYEQMIQQNQ
QIPIKDEILLAINPSNILMCDSIGLNRPKRRVQIKNIQKFCCTEKEVIVISHDNTKHIFE
TPQYCREIAFLIRSYLRIFYQKQQQQQQQEKSQ


>TTHERM_00112430(gene)
ATGAATAAAAGTTATTAAGAATGGATTAATCCTAATGTAGAGTGTTGGGTTTGGCTCAAA
TATGAAAATTCTTAGCAAAATTAAAACAATTCTGAAAATGGATAATATTTCTAGTGCGTT
ATTCAATCAGTATAAAAAGAAAAGAATTTAGCAAAGATAAAAGTTACTTGTAAAGAAGAA
TAATTAGGAAATCGAATATCAGATTAAGCAATTAATGGATAATTAGATGTTTAATTTGAA
AGATTATTAGAAAAGGAAATTATGGTTGATTCTCTTCAAACTTTAGGTTATTCAGATATG
GTTCATATGAAGTATTTAAATGAGGCTGAAATAATCAATAATTTGAGAAAGCGATATTAA
AATAATATGATTTTCACATATATTGGACCAACTTTGGTAGTTATGAATCCATATAAAGAA
ATAGAAGGAGTATAAGATAATCAAGTAATAGATAAAATAAAATCTGATCTAGGCATAAAA
TTTGAAGAGGATTTCAAAATGAATAATCTGAGCACCAACTAAAATATTATAAACACACCT
CATACATATACTGTAAGCGGATTAGCCTACAAATAAATGTTTAGCAATAAGAAAAATTAA
GCAATAGTTATATCAGGCGAAAGTGGAGCAGGTAAAACAGAAAATGCTAAATTATCGATG
CAATTTTTAACAAGTTTGAGTTCAGGGTCTGATAAATAAAATGATTTACTCAATTAATTA
AAGACTCAAACAGCTAAGAATATTCTATTAGAAGAGTTTAACTAATTTGCAATAGAAGTA
AAAATACTTGCTTGTAATCCTATTCTAGAAGCTTTTGGTAATGCTAAAACAGTAAGAAAT
AATAATTCCTCTAGATTTGGTAAATACGTAAAAATCTACATAGATAAAACATCTTAAAAG
ATAAATGGAGCCTCCATTGATAGCTACTTACTCGAAAAGAGCAGAATACCTTGTCCAGGA
AAGGGAGAGAGAAATTATCACATTTTTTACCACATGCTAAAAGGAAATCAAGAACTATCT
AATTTGAGATTGAGTTAGTTCAAAAATTTATCTGATTTTGATTATCTAAAGAAAAGTGAC
TGCTTTGAGGTTGAGAACATTTAAGATGCTAAACTCTATTTGGAAGTAAAGAAGTCCTTC
AGATAAATGAATTTCTCTAACTAAGAGTAAGAAGCTATATTTTCTCTAATATCTGCGATA
CTACTGTTAGGCAATGCAAATTTAGACTCATCAAAAGCTAGCGACACTCAGGCTCCAACT
TTTTTGAACATGAGTTTACCGACACATCATAAAGAATTCAAAAATGCCTCTGAGTTACTC
TAAGTTAATCCTAAAGACCTTGAAGAGTCTTTAGTATTTAAGGTAAGGAAAGTTGGAACT
ACAGTAATTAAATCTCCATAAACTGCTGAAGAATGCTTGTCTATGAGAGACAGTCTAAGT
AAAAATCTATATGATAGTCTTTTTAACTTTTTGGTTTGGAAGTTAAATTAAAATTTGTTG
CCACCTTAAGATTTGCTAAATAAATCATTAAGCATAGGCCTTTTAGATATATTTGGTTTT
GAGAGCTTTGATATAAACTCATTTGAGCAGCTTTGCATTAATTTTACCAATGAAAAATTT
TAGTAATTGTATGTTTAATATGTTTTCAAAAGCGAAGAAGAAGATTATAAATAAGAAGGA
ATTTTGGATGTATTTTCTGATTTATAATATTAAGAGAATTAGCTCATTATTGATACAATT
GAAAAAAAACCCAATGGTAAATTCTTATTTTCATATTTTACATTTTGATTTATATTTTAT
TTAAAGGAATCATGGTGCTTTTAGATGAAAATTGCTCATTGGGATCAGGGACGGATGATT
CTTTTTTAAATTAAATTACAAAAAACCACTCTAAAAATCAACTTGTCAGCTTCCCTAAAA
AAGATAAATATTCTTTCAGCCTTAGTCATACAGCAAAACAAGTTGTATATGATGTGCGCG
GATTTAGAGATAAAAATAAAGATGAAGTGAGTACCGAAGTAGAAAAATGTCTTTAAAGTA
GTAAATGTCCAGTTATTGCGAATTTATTATCTTATTAAGGGTCTTAAACTTAGTAGAATA
AAGAAACTTAAAATCTTCAAAATTTTGGAAATAATTTAAATTTTAAAAAAGCTGAAATTA
GTAATCAAATGAACTCAAGTAAAAAGAATGTAAAGTTTCTAGGCTAAAAATTTAGATAAT
CTTTATAGGAATTAATGATAGAATTGAATAATAGCGATGTTCACTTCATAAGATGTATAA
AACCAAACGAAGAAAAGAAAAAGAATTTTTTTAAGTATGATTATGTTTATTAGCAAGTAC
AGTATTTAGGCATACTTGATTCCATTAAAATCCGCAAAGTTGGATATTCTTACAGAATGA
CTTATGAAAACTTTTTCTTAGAATACCAAGAACTGGGATAGAAAACAAAAGGATTAACAT
TGTAGAAGGTTTAGCAATAAAAGTTAGATTTAAAATAATTAATTACAACAGAAATATTTG
AAAAGACCAATTTATTGCAAAATAAATAACTTCCTTAGAAATGTGTAGCATTTGGAAAAA
CAAAAATATTTCTCAAAAATGAAGTTATGAAGATTTTGCATGAAAAAATTTAAGAAATTA
TTTAATAAAGAAAAAAATATGCAAAGCGAATTATTGTCTCAATTTAAAAATATCTGTTTA
GGAAATACTTCCATAAGAATTTAATGAAAATAAAAAATTAATTAATTAAATTGCAATCAT
TTGCTAGAATGGCTATTTAAAGATAAAAATTCCTAAGGAAAAAGAAATCAATATTAAAAA
TGAAGAAGCTTATTAGGCTAAGAATGTTGGGATAAGGAATCTCTGCATTTAGGTTAAACT
ATATCTCATTTGTGTGGGATTTGGTTTGTTTTATGATATTTGATAAAACAAATATTCATA
TTGCATTTTAGTAAATTAAATATTATCGTAACCCAAATAAAACTAAGCCTGTTGTTCAAA
ATTAAACATCTACAATTTAGTAAAATAAATAGTAAAATCAACAAGTAAAATTAAAATAAA
TATTTAAATGTTTATTTAAATTTTTTTATTTTAAAATAGCCTTAAAAAAGCCAAAATTAA
GTTACTTCATCATTTTAAGTAAATAATTAAATGATGCAATAAAAATAAAGTCTTGTAGGC
CAATAAATTTAATCTATTGTAAACGAGCTTAATTTAGGTGAGATATAAATTAATAAAACC
TAACAAGATTTAAAAGACTTTAGAAAATCAAAGATTATACCTTAAGTTAACTTGAATCCA
TCACAGTATTTAATTTTATTTAAATTATTTATTTAATTCGTACAAATTTTAAGAGAAATC
AAAATCTATAAAAAATTTTTTTAGGATTTAAAAATTTGAGCTATGATTAGATGTTAAACA
TTTTCTTATTTTGCATTAAATTGAATTTAAATAAAATCATGCAATTATTAATTTGAAAAT
CAATTTAAATTAAATTAATAATAAAAATTTTAGTGAAATTATTAAGACCTACACCCATAA
AATGGATTGAAAAAATATTTTCACTACTTAAAATATTTGTTTTAATTAAATTTTAAATAA
AAATTAATTAGTAGTAGTAAGAGGGCCAGCAATGCTTGGAGATAAACCCTAATTGCAAGT
AGTAGTTAAAATAAAATTAATAAAGATTTGTAGCTATCTGAATTAGGAGAGTAGAAGCTG
ATAAATATGAAAGAAACAACTGACTAAAAAGAAAAAATTAAATATACTAAACCTCTGATA
TTATAATTTACAGAGTATAACCCTGCTTATTAGTATGCAGAGTTTAATATGGAGAGTGCA
ATAGATTTAGAAGATGTTCCTAATAGTTTAGATTTTGAGGGTGAATTAAATGATTTGATA
AGTGAAGAAATCATTCAATAAATAAAAAAAAATAACTTTTATTCACACCTTTCTTTTATT
CTTGCAAAAAGAACAAAATGGGGAATCACACAAACTTAAGAGAAAATAATGAGGCACTAG
CTTAAACCAATTTCAAATCCACTAACAAATATTGCTGATTTGAAGAATATAATCACCTAT
GAAGACACAAAAGATGCTGTTTAATCAATTAGGAGTATTATTCAATAAAATAATTTATAT
AATGACACATCAACATAGACTTAAAGACCAATTAATTATGAAGATGCTAGAACTGGAAAA
TTAGATAAGTAAGTATCTAAATAAATTACTAACGATTAATCACAAAAATTAGCAACTGTC
TTTTCGAAATATTCTCTGATGAACCCAAGAAAAGCTAGTGTTAGAGACACAAACTCACTT
GAACAAATTGTCCTATAATAAAGAAAACTTACAAAATTAATTTAGTATAAAAAATTTTCT
CCTTCAGAAAAAGCTATTAACATATTTAAAACTCTCTTAAAGTGCACAGGAGAAAGAAAA
TCCCGATATAACAGACACAACAATATCATAAAGCTTCTTACCCTTTGTAACGAAGAGTCA
ATCGACCTAAAAGAAGAAGTAAATTAAAATTTTTTTGTCAAAATACATATTTGATTTTAA
TCTCTTTTTCTTTTTTTTTTAGTGAAAAATAAGAATAAATTAAAAAAAATAAATGCTTTA
TCAATAAATAAAAATTTTATCAGCATTAATTAAGTTTTTAAACTAATATTTTAATCTTTT
ATGATTCAAATAACATTTTTGAAAACCATTTTTTAAATATGCATTTTGGGAAATTTTAAA
TTGATGAATTAAAATATTTTAGGTTTACGTTTAATTATGCAAATAATTAAGTGCAAATGA
TAAAAAGGAGTCAAGAATAAAATATTTAAAGCTGTTTGCTATTATAAGCAGCATACTGCC
AACAACCAGTAGATTTTATTATCCTTTACTTCACTTTTTATATATGAGAAATACAGATAC
TCAAATAGAATAGGATGAGAGAAAATGGTACTAATACTGTTTTCAAAGAATTTATAAAAG
TGAGTAAATACAAAGAGGATGCATCCCAACTGATACTGAAATTGTAATGATTGAGAATAA
GAAACAAATTTTGATTAGAGTTTATCTTCTAAATGAAATCCCAATTACTGTAGGAGTAGA
AAGCTATACTAGTGTGAAGATGCTTAAGCAGGAGCTACTTTAGAAAATAGGTATAACCTA
AAGACATGAATATTATGGCCTTATGGAAGTAAGAAACAATATTAAGAAAAAGAGAAAAGA
AACGAGATTTATAGATGAAAGTGAGAGAGTAATGGATGTGATAGCTTTTTGGGAAAATGA
GTAGTATTTATTTGGATCTCAATTAAATTCTTCTTTCATACATAGCAACTCAAAATAAAA
TGATGAAGGTATTGAGCAATTCAACCTTTAAAATTATTAGGATCTTGAAGGACTTAAAAT
TTACCTTGGAATCAGAATACTTTTTTCATTTTAAGAAAACGATAAAGAAGCAATAAGCGT
TTTCTACACTTAGCTATCTTCAGAAGTACTTGAAGGAAAGTATGCACCTTTGGAGGAAAA
AGATTACTTGAATTTGGCTGCTTTATAACTGTGCATAGATTTTCCAAGAGACGTCATTTT
AAAAGAAATATCTAAAAGATAGAGTATCAATGCAGATAGTGGGTCTCCATAAAGAACATA
GAGTAATTTTTTGAGTGCTACTAGCTAAAGTGAAAGCGGTGCATCACAGCTTAAAAAGCT
TTCTTATTAAGATATTGAACAGATTGATGAATAAGATGAATACGAACAATTCATATAAAA
TAGAAATGAAATTTTAATTGATCCGGTTTTTTACATACCAGCTAAAATGTATTTCTAAAA
AGATATTCAGTAATGGTAACACTTAATACTATAGAATTTGGTTGATAATAGACTTTTAAA
GAAAGAGTACACTCCATCTTAAGCAAAGTTAGCCTACATACTTTATCTTAGTAAGTAAGA
TTTGTTTATGAGTACAATATTTAGAGATGTAAAATACCAAAGAATCAAAATTAAAACACT
AAATGACACACTTTCTTCTAAAGAAAAATATGAGCAAATGATTTAATAAAATTAACAAAT
TCCCATTAAAGACGAGATACTTTTAGCAATAAACCCATCTAATATTCTGATGTGCGATTC
TATAGGTTTAAATAGACCAAAAAGAAGAGTGCAAATTAAAAATATCTAAAAATTTTGCTG
CACTGAGAAGGAAGTTATAGTAATATCTCATGATAATACAAAACATATTTTTGAAACTCC
CCAATACTGTAGAGAAATAGCTTTCTTAATTCGCTCTTACTTGAGAATATTTTATTAAAA
ATAATAGTAACAACAATAATAAGAAAAAAGTCAATGA