Identifiers and Description

Gene Model Identifier

TTHERM_00160750

Standard Name

MXR4 (Methionine sulfoXide Reductase)

Aliases

PreTt28467 | 13.m00426 | 3829.m01282

Description

Methionine (R)-sulfoxide reductase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

  • peptide-methionine (S)-S-oxide reductase activity (IEA) | GO:0008113

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 14.9%

TetraMine Data

TTHERM_00160750

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05333.19.995516318087232e-125SelR domain-containing protein
(243 aa)
OxytrichaContig11900.0.g261.0003081162615753e-33SelR domain
Stentor CoeruleusSteCoe_164300.000000000005109089028063325
DictyBaseDDB_G02911450.000000000040005666873964816msrB on chromosome: 5 position
5047547 to 5048311
WormBaseWBGene000184190.0000000010002658722841845Uncharacterized protein F44E2.
6 status:Confirmed UniProt
:P34436 protein_id:CCD71223.
1
SGDYCL033C0.000004000864880866421MXR2 Methionine-R-sulfoxide re
ductase, involved in the respo
nse to oxidative stress; prote
cts iron-sulfur clusters from
oxidative inactivation along w
ith MXR1; involved in the regu
lation of lifespan

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00160750(coding)
ATGAGGAAAGATATTAAGTAGAAACTTCTTAGAATCAAAAAAAAGAAAAAGAAGGATAAA
AAATAATCATAAATAAAAAATATTAAATTTCTATTGATTTTAACACAATATTAGCAAGGA
TTGTAAAGTCAATCAAAAGATTAAAAATATAAAAGTATTATAAAATATAATAGAATAAAG
CTAGAATTTATGCGCAGCGTCATTCAATAAACTTGGAAATACTAAAGCTTAGTCAGCAAG
TATATGAGATATAACTTCTCTTCTGCTGTTCATGCTGAGCCTATTGCTACAACTCAATCA
GCTAATAATTAGGAGAAAAAATCAAATAAGAATGCAGATTAGCCAATTAAAGAAGTAGTT
TAAAAAGAGTTTAAGATTAATAGATTAAATTACACTCCTCATGAATATTGGATTACTTAA
GGTATGGGAATGGAGAGACCTTTTACTGGTGATAAATGGTTTGAAAAAGATGTTGGTTAT
TATCACTGCACTGTTTGTAGCACTAAATTATTTACTTGGGATCATAAATTCCAAACCCCT
AATGGTATGACATCTTTTTGGCACCATGAAAAGAATGCAGTTAAAGTTGTTGAAAACACT
AACGGAATTTAGGAAAGTTTTATCAATTTAGAATCAACTCCTAGCTAAATAAATCAAAAT
GCCCAAAAATAAAGAGTTTGCTGCTCCAAATGTTAAAGCAATCTCGGATTGGTCTTCTTT
GATGGTCCTCCTCCTACTTTCAAAAGATTCTCTATCAGCTCTGCAGCTATTAAATTTATT
AAAAAGGAACATTGGGAAAATCCTCATCTCGTTTCTCGTAAGAGAAAATTCAAGTTAAAC
ACTGAAAAGGAAGTTGAAAGAAAGCGTGAAGTTTTAAAATCATAATAATAAGATATTGTT
GCTAATTCTTCTTCTTCTCAAACTTAAAATTGA


>TTHERM_00160750(protein)
MRKDIKQKLLRIKKKKKKDKKQSQIKNIKFLLILTQYQQGLQSQSKDQKYKSIIKYNRIK
LEFMRSVIQQTWKYQSLVSKYMRYNFSSAVHAEPIATTQSANNQEKKSNKNADQPIKEVV
QKEFKINRLNYTPHEYWITQGMGMERPFTGDKWFEKDVGYYHCTVCSTKLFTWDHKFQTP
NGMTSFWHHEKNAVKVVENTNGIQESFINLESTPSQINQNAQKQRVCCSKCQSNLGLVFF
DGPPPTFKRFSISSAAIKFIKKEHWENPHLVSRKRKFKLNTEKEVERKREVLKSQQQDIV
ANSSSSQTQN


>TTHERM_00160750(gene)
ATGAGGAAAGATATTAAGTAGAAACTTCTTAGAATCAAAAAAAAGAAAAAGAAGGATAAA
AAATAATCATAAATAAAAAATATTAAATTTCTATTGATTTTAACACAATATTAGCAAGGA
TTGTAAAGTCAATCAAAAGATTAAAAATATAAAAGTATTATAAAATATAATAGAATAAAG
CTAGAATTTATGCGCAGCGTCATTCAATAAACTTGGAAATACTAAAGCTTAGTCAGCAAG
TATATGAGATATAACTTCTCTTCTGCTGTTCATGCTGAGCCTATTGCTACAACTCAATCA
GCTAATAATTAGGAGAAAAAATCAAATAAGAATGCAGATTAGCCAATTAAAGAAGTAGTT
TAAAAAGAGTTTAAGATTAATAGATTAAATTACACTCCTCATGAATATTGGATTACTTAA
GGTATGGGAATGGAGAGACCTTTTACTGGTGATAAATGGTTTGAAAAAGATGTTGGTTAT
TATCACTGCACTGTTTGTAGCACTAAATTATTTACTTGGGATCATAAATTCCAAACCCCT
AATGGTATGACATCTTTTTGGCACCATGAAAAGAATGCAGTTAAAGTTGTTGAAAACACT
AACGGAATTTAGGAAAGTTTTATCAATTTAGAATCAACTCCTAGCTAAATAAATCAAAAT
GCCCAAAAATAAAGAGTTTGCTGCTCCAAATGTTAAAGCAATCTCGGATTGGTCTTCTTT
GATGGTCCTCCTCCTACTTTCAAAAGATTCTCTATCAGCTCTGCAGCTATTAAATTTATT
AAAAAGGAACATTGGGAAAATCCTCATCTCGTTTCTCGTAAGAGAAAATTCAAGTTAAAC
ACTGAAAAGGAAGTTGAAAGAAAGCGTGAAGTTTTAAAATCATAATAATAAGATATTGTT
GCTAATTCTTCTTCTTCTCAAACTTAAAATTGA