Identifiers and Description

Gene Model Identifier

TTHERM_01289140

Standard Name

MXR3 (Methionine sulfoXide Reductase)

Aliases

PreTt20224 | 310.m00039

Description

Peptide methionine (S)-sulfoxide reductase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

  • oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor (IEA) | GO:0016671

Biological Process

Domains

  • ( PF01625 ) Peptide methionine sulfoxide reductase
  • ( TIGR00401 ) peptide-methionine (S)-S-oxide reductase

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 23.6%

TetraMine Data

TTHERM_01289140

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20964.14.9996115996408327e-110peptide methionine sulfoxide r
eductase (208 aa)
DictyBaseDDB_G02765791.000403801267624e-40msrA on chromosome: 2 position
7002973 to 7003576
SGDYER042W2.999534586690157e-23MXR1 Methionine-S-sulfoxide re
ductase, involved in the respo
nse to oxidative stress; prote
cts iron-sulfur clusters from
oxidative inactivation along w
ith MXR2; involved in the regu
lation of lifespan
WormBaseWBGene000183931.000116773704384e-19locus:msra-1 status:Confirme
d UniProt:O02089 protein_i
d:CCD63544.1
Stentor CoeruleusSteCoe_159090.000000000000001713908431542013

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01289140(coding)
ATGAATAATTCGGAAGTTGCTGTTTTAGGAGGTGGTTGTTTTTGGTGTATTTATGCTGTC
TTCAAGAGAGTCAAAGGAGTTCAAAAAGTTATTTCTGGTTTTTCTGGAGGTGAGTTGAAG
AATCCTACTTACAAAGAGGTTTACACAGGAACAACAGGACATGCTGAAGTAGTTTAGGTT
ACTTTTGATCCAGAAGTTATTTCTTACGAAAATCTCCTCAGAATCTATTTCAATGTTCAT
GATCCAACTCTATTAAATAGATAAAATGATGAGGATGTAGGAACTCATTACAGGTCAGTA
ATTTTTTATTTGAGTGAATAATAACAAAAGACAGCTTTAGCTCTCATTAAAGAGCTTGAA
GAATCTAAGTATTACAAAGATCCTATTGTAACTAAAGTTGATAAATTTGAAGAGTTTTAC
CCAGCTGAAGATTACCATCAAAATTACTTTGATATTAACCCTGAACAAAGATACTGCAAA
GCCGTAGTAGAACCTAAATTAAAGAAATTTTTGATTAAATATAAAGACTACTTAAAGCAA
GAAGAAGAAGAATTAAAGTAAAAATAATTATAGTAAGAATAATAGTAATAATAATAATCA
TAGTAATGA


>TTHERM_01289140(protein)
MNNSEVAVLGGGCFWCIYAVFKRVKGVQKVISGFSGGELKNPTYKEVYTGTTGHAEVVQV
TFDPEVISYENLLRIYFNVHDPTLLNRQNDEDVGTHYRSVIFYLSEQQQKTALALIKELE
ESKYYKDPIVTKVDKFEEFYPAEDYHQNYFDINPEQRYCKAVVEPKLKKFLIKYKDYLKQ
EEEELKQKQLQQEQQQQQQSQQ


>TTHERM_01289140(gene)
ATGAATAATTCGGAAGTTGCTGTTTTAGGAGGTGGTTGTTTTTGGTGTATTTATGCTGTC
TTCAAGAGAGTCAAAGGAGTTCAAAAAGTTATTTCTGGTTTTTCTGGAGGTGAGTTGAAG
AATCCTACTTACAAAGAGGTTTACACAGGAACAACAGGACATGCTGAAGTAGTTTAGGTT
ACTTTTGATCCAGAAGTTATTTCTTACGAAAATCTCCTCAGAATCTATTTCAATGTAATC
GCCATAAGAAAAATTGATTTAAAATAATAAAAATAATTTTGTAATTAATAGGTTCATGAT
CCAACTCTATTAAATAGATAAAATGATGAGGATGTAGGAACTCATTACAGGTCAGTAATT
TTTTATTTGAGTGAATAATAACAAAAGACAGCTTTAGCTCTCATTAAAGAGCTTGAAGAA
TCTAAGTATTACAAAGATCCTATTGTAACTAAAGTTGATAAATTTGAAGAGTTTTACCCA
GCTGAAGATTACCATCAAAATTACTTTGATATTAACCCTGAACAAAGATACTGCAAAGCC
GTAGTAGAACCTAAATTAAAGAAATTTTTGATTAAATATAAAGACTACTTAAAGCAAGAA
GAAGAAGAATTAAAGTAAAAATAATTATAGTAAGAATAATAGTAATAATAATAATCATAG
TAATGA