Identifiers and Description

Gene Model Identifier

TTHERM_00136330

Standard Name

MXR2 (Methionine sulfoXide Reductase)

Aliases

PreTt24358 | 10.m00407 | 3698.m00126

Description

methionine (R)-sulfoxide reductase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

  • peptide-methionine (S)-S-oxide reductase activity (IEA) | GO:0008113

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 17.1%

TetraMine Data

TTHERM_00136330

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05798.11.99970314379378e-94methionine-R-sulfoxide reducta
se (211 aa)
WormBaseWBGene000184193.00039543526891e-44status:Confirmed UniProt:Q1W
0S5 protein_id:CCD71224.1
DictyBaseDDB_G02911455.001425520048966e-32msrB on chromosome: 5 position
5047547 to 5048311
SGDYCL033C3.99801309251602e-27MXR2 Methionine-R-sulfoxide re
ductase, involved in the respo
nse to oxidative stress; prote
cts iron-sulfur clusters from
oxidative inactivation along w
ith MXR1; involved in the regu
lation of lifespan
Stentor CoeruleusSteCoe_260333.532628572200807e-24
OxytrichaContig11900.0.g263.0007793728221555e-22SelR domain

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00136330(coding)
ATGATTAGACTAATTAATAATTTCAGTAAACAAATAAAAAATACAACAAACAAAAAATAT
CTGCTAATACCTTTAATAGCATATTCATTTGTGAAATCTCAACCAAAGTAGATTTAACTC
TATACATAACCCAATCAACAATAATTTTCGTCTTCACCAATGCAAAAGTAGGAATTCCCT
TTCAAAGTTAATAAAGAAGAATTAAAAAAACGTTTAACACCTATTCAATATAAAGTTACT
TAAGAAGCTGACACAGAACGTCCTTATACAGGATAATACGATAAGCATTTTGAATAAGGT
GAATATTTATGTATCGTATGCTCTGAGAAGTTATTTAATTCAGACAGCAAATTTAATTCA
GGTTGCGGATGGCCTGCTTTTTCCTCAAGTGAGTAGGGAAAGATTTAAGAAAATGTAGAC
CAATCTCATGGTATGGTAAGAACTGAGGTTGTTTGCAAAAATTGTGGTGCACATTTAGGT
CATGTTTTCAATGATGGTCCTAAGCCCACTCATCTCCGTTACTGTATCAACTCTGCCTCA
ATTAACTTCAAAAAAGCTAATTGA


>TTHERM_00136330(protein)
MIRLINNFSKQIKNTTNKKYLLIPLIAYSFVKSQPKQIQLYTQPNQQQFSSSPMQKQEFP
FKVNKEELKKRLTPIQYKVTQEADTERPYTGQYDKHFEQGEYLCIVCSEKLFNSDSKFNS
GCGWPAFSSSEQGKIQENVDQSHGMVRTEVVCKNCGAHLGHVFNDGPKPTHLRYCINSAS
INFKKAN


>TTHERM_00136330(gene)
ATGATTAGACTAATTAATAATTTCAGTAAACAAATAAAAAATACAACAAACAAAAAATAT
CTGCTAATACCTTTAATAGCATATTCATTTGTGAAATCTCAACCAAAGTAGATTTAACTC
TATACATAACCCAATCAACAATAATTTTCGTCTTCACCAATGCAAAAGTAGGAATTCCCT
TTCAAAGTTAATAAAGAAGAATTAAAAAAACGTTTAACACCTATTCAATATAAAGTTACT
TAAGAAGCTGACACAGAACGTCCTTATACAGGATAATACGATAAGCATTTTGAATAAGGT
GAATATTTATGTATCGTATGCTCTGAGAAGTTATTTAATTCAGACAGCAAATTTAATTCA
GGTTGCGGATGGCCTGCTTTTTCCTCAAGTGAGTAGGGAAAGATTTAAGAAAATGTAGAC
CAATCTCATGGTATGGTAAGAACTGAGGTTGTTTGCAAAAATTGTGGTGCACATTTAGGT
CATGTTTTCAATGATGGTCCTAAGCCCACTCATCTCCGTTACTGTATCAACTCTGCCTCA
ATTAACTTCAAAAAAGCTAATTGA