Identifiers and Description

Gene Model Identifier

TTHERM_00624870

Standard Name

MUS81 (Homolog of budding yeast MUS81 and fission yeast mus81)

Aliases

PreTt07475 | 87.m00255 | 3814.m00957

Description

ERCC4 domain containing protein Involved in meiotic crossover formation

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00624870

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_12061.19.997093137033517e-262ERCC4 domain-containing protei
n (547 aa)
DictyBaseDDB_G02765191.9996410647472548e-29mus81 on chromosome: 2 positio
n 7009387 to 7012149
OxytrichaContig15747.0.g745.0013199114200274e-20ERCC4 domain
SGDYDR386W7.997402223525235e-19MUS81 Subunit of the structure
-specific Mms4p-Mus81p endonuc
lease that cleaves branched DN
A; involved in DNA repair, rep
lication fork stability, and j
oint molecule formation/resolu
tion during meiotic recombinat
ion; helix-hairpin-helix prote
in
WormBaseWBGene000166020.0000000000599805963605737locus:mus-81 status:Confirme
d UniProt:P91153 protein_i
d:CCD65150.1

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:23935123: Lukaszewicz A, Howard-Till RA, Loidl J (2013) Mus81 nuclease and Sgs1 helicase are essential for meiotic recombination in a protist lacking a synaptonemal complex. Nucleic acids research 41(20):9296-309

Sequences

>TTHERM_00624870(coding)
ATGTTTTAAAAGACTAGGGCCAATAAAAGCGCACTTCACCCATGTAATTAATTTATAGTA
GATAAATTTATATAGCTCGAAAGATAATAATAAATGAGAAGAGCCACAAATATGAATTTT
ACTTATTCAAAAATAATTAAATCTCTTTAAAAATATCCTTTACCAATACTATCAAGATAA
TAAGCTCTGCAGTTAGAAAATGTTGGAGAAAAAATGGCTAATTTGATTTATAGCTTGATT
AAATCTCATTATAAAGATTATTTAAAGAATCCTAATCAGGATTTTGAAGATGCAGTGTGT
TCAGATTCAGACGAAGAGAAAAAGTAAACTGAGAATAATAATAGTAATAGACATAATGCA
AATTCTAAATCCAATTCAGAATGCTCTTCAAAAAATTCTACTAACTTATTTTAAAAACCA
ACTAATTCCTTTAATTCTAAACTTTTGAATAGAGAGTACAATAAAGATAAGGATTTTGAG
GAAGATATTCCTAAAGACTTTAATGGTATAAAAAATACGATAAAAAATTCTAAAAAATAA
AAACCTTCAGCTGAAGAAGAAGAACTCAGTAAAAATAAAGGAACACAAAAAATTATTTCT
TTATTGAGTGATTCAGAATAATAAGAGTGTAAAATTAATAAAGACAACACTTTGTATAAT
ATCCTCAGTTAATATGTAAAGCCAGAAACGAAAAGCGATTTATAGAATAAACTAGACAAT
AAATAAAAGGAAGACAATCTAATTGAAAATCTTAAAAATAAATATGAAAATAGCCCTATA
AAACTAAAAAGCTTGGAAACAAATGAATAAAAAAATAATTTAAATGTTAGCAAAAATTAA
GAAAACAAAAATGAAGATGGCCTTAACATTAATGAGATGGAATTAAATTTTAATGAAAAA
GAAGAAGAAGAAGAAAATAATGATAATTAGTAATTTAATAAATTTAAAAAAATATTTGAT
GAAAAATAAGATTATGAAGATGACGCTTTTAAATTTTAAAATGATATTCTAAATAGCTTC
AAGCTTAATAGTAAAAATAAATTGTAAAGGTAATAAACTAATTCAAGTAATGGAGGTATG
AAAAAAATATAAATTGATTCAGATTAAGAATCAACATTACCTTAGAATAAAGAATCATCC
TCTTCTTCTAAGAAGTCTTCAGTAAAACCTTAAAACGGAAATATTTCATTTCTTAGTGAA
GAAGAAGATCTTAAAGTAATATAAACATTATAGGATTCATAAAACAAGAAGAAAAGAAAA
TTTAACCCAAAAGAATACACAAACAATTGGGCTATACTGATATGTCTTTATTGCTTAAAA
GAAGAATTTAAAAAGAACTCTGCATCTATCAAAGATATAAAACAAAAAGCTAAATCAATA
TCAGAAGAAATCGATCACTAATTTTAAATTAAAAATTTCAACCAAACAGACTCTCTTCTC
AACAATGATCTAATTATTGTATAACTAGTTTAAGGTGAAAAAATATTATCTTTAACAAGC
ACTGGTATTGAATTATCATAGAGTTTATATCACAAGCTTGTTGCTAAATCATTAGCAGGA
ATTTAAGAAAACTCCTAAGAAAATGCAAATAGTTAATAAAAATAATATGATTTAAACTAA
AGTTAAAATTAATCAATAATGGAAGTAGAAGATTAATATGTAGAGTAATATGAAATTAAG
AAAATAGAATCTTAATAACCAAAGAAGATAGAATAATATGAAAAAATGAAACTAGAATAA
TATGAAACAAAGAAAAGAGAAAAATATGATACAGAGGAAATAGATAAAAAACTAAATAAT
TAAAACTCAAGATTATAAAATGAATTTGATGATTACATGGATAAACTTGATTGTGATAGC
AATTTTAATAACATTTTAGATTTTTTAGAAAAATCTGAACAGCCTATTAATTATTCAAGA
TCAAAAACAGCTTTTTTATCTTCTAATCCTGAATCACTAAGTTCTAAGATGGGTAGTATT
TACAATCCTCAAAATAATAAAATAAAATTTGAAAAATTTGAAGAGAATTTTTCTGATAGG
AATTCAGACTACGATGAAAGAATAAAAGAGTTGGATCAATTTAATTCTTAATTTCCCTTA
CCGGTATAAAACTCTAAAAAAAATAAAGGTACAAAGAAAGAAAAAAAAGTTATTGAGCCT
TTATAGTAAAGAAATATTTTCAAAGAATAGAAAATAAAATAACTTTAAGAAATTGAAGAT
GATGATATTGAAAATGAAGCTATAAACAATTCTCTTCCATTTTCTAGTAATCGCTCTATC
CCTAATTAATTATCTCTTGGAATAAAATAATCAAATGTTAGTTAAAAAATTGTAGAAAAA
ATATCTCTTAATAAAATAGCTAAGGGAATGATTAAGGAGTATGAAGTTTATTTGATTATT
GATATAAGAGAAAGAACAGATAAAAACGAAAGAGATTTAGCTATCAAATAAAAATTAGAG
GAAAATGGTGTCTGCTGTAAAATAGAAAATATATATTTAGGTGATTTTTTATGGGTTGTT
GATATAACAACTATCGATAACGTGACAGAAACTTATGTATTAGACTATGTAGTGGAAAGG
AAAACAGGTGATGATTTTGCTTCAAGTATTTAAGATCACAGATATAAGGAGTAGAAATAT
AGATATAAGAAAAGTGGGTTGAAGCATTGTTACTATCTAGTTGAAGGAGATATTAAGAAC
ACTAAGCATTTATCAGTGTCATAAAGTGCTATTGAAACGGCAATAATGACTACTTAAATG
ATTGATAAGTTTAAAGTGCAGAGAACTAAATCTTTCCAAGAAAGTATGATATGGATCAGT
TGTTTGCATAAAAATATACTAAAACATTTCAACGAATACATATCAAGCATAAACGATGAT
CATATTTTAAATTTTTAGTATACAATGTCAGAATATCAAAAAAATAATAAAAAAAATGGT
AATTTAACTCTTAAAGAATAGTTTGGACATTTTTTAAGATCTATTAATGGATGTGGAGCT
TAACAAGTTTAAGTTCTTACAGAAATCTTTTAGACCCCAATAAATCTAATATCAAATTTA
GGAAGTTAAAGAAATTTACAAGAAAGAATAGAGTTAATAATAGATTAAACAAAATATAAT
AAGAATTAGCTAAAAGCATAAGGTATGGATGCAAGGGTTATTTCCAAATCTTTAGCTACT
TCAATAGCAATTTTATTTGGTGAAGACAAGTATCCTAAAGAAAAATTAGAAGATGGTGCT
TGA


>TTHERM_00624870(protein)
MFQKTRANKSALHPCNQFIVDKFIQLERQQQMRRATNMNFTYSKIIKSLQKYPLPILSRQ
QALQLENVGEKMANLIYSLIKSHYKDYLKNPNQDFEDAVCSDSDEEKKQTENNNSNRHNA
NSKSNSECSSKNSTNLFQKPTNSFNSKLLNREYNKDKDFEEDIPKDFNGIKNTIKNSKKQ
KPSAEEEELSKNKGTQKIISLLSDSEQQECKINKDNTLYNILSQYVKPETKSDLQNKLDN
KQKEDNLIENLKNKYENSPIKLKSLETNEQKNNLNVSKNQENKNEDGLNINEMELNFNEK
EEEEENNDNQQFNKFKKIFDEKQDYEDDAFKFQNDILNSFKLNSKNKLQRQQTNSSNGGM
KKIQIDSDQESTLPQNKESSSSSKKSSVKPQNGNISFLSEEEDLKVIQTLQDSQNKKKRK
FNPKEYTNNWAILICLYCLKEEFKKNSASIKDIKQKAKSISEEIDHQFQIKNFNQTDSLL
NNDLIIVQLVQGEKILSLTSTGIELSQSLYHKLVAKSLAGIQENSQENANSQQKQYDLNQ
SQNQSIMEVEDQYVEQYEIKKIESQQPKKIEQYEKMKLEQYETKKREKYDTEEIDKKLNN
QNSRLQNEFDDYMDKLDCDSNFNNILDFLEKSEQPINYSRSKTAFLSSNPESLSSKMGSI
YNPQNNKIKFEKFEENFSDRNSDYDERIKELDQFNSQFPLPVQNSKKNKGTKKEKKVIEP
LQQRNIFKEQKIKQLQEIEDDDIENEAINNSLPFSSNRSIPNQLSLGIKQSNVSQKIVEK
ISLNKIAKGMIKEYEVYLIIDIRERTDKNERDLAIKQKLEENGVCCKIENIYLGDFLWVV
DITTIDNVTETYVLDYVVERKTGDDFASSIQDHRYKEQKYRYKKSGLKHCYYLVEGDIKN
TKHLSVSQSAIETAIMTTQMIDKFKVQRTKSFQESMIWISCLHKNILKHFNEYISSINDD
HILNFQYTMSEYQKNNKKNGNLTLKEQFGHFLRSINGCGAQQVQVLTEIFQTPINLISNL
GSQRNLQERIELIIDQTKYNKNQLKAQGMDARVISKSLATSIAILFGEDKYPKEKLEDGA


>TTHERM_00624870(gene)
GTTTGAAATTTATTAAAAATAAGTAGCAAATATTAGTAGACCCTATTTAAGATTTTCAAC
AGCAATTAAATTCATGTTTTAAAAGACTAGGGCCAATAAAAGCGCACTTCACCCATGTAA
TTAATTTATAGTAGATAAATTTATATAGCTCGAAAGATAATAATAAATGAGAAGAGCCAC
AAATATGAATTTTACTTATTCAAAAATAATTAAATCTCTTTAAAAATATCCTTTACCAAT
ACTATCAAGTAATTATTAGTTAGTTTAAAACAAAATATTTTATCAATCCAATTGAATTAA
TTATTTTAAATTTACAATTATTTCTTCATTTCAAAAAGGATAATAAGCTCTGCAGTTAGA
AAATGTTGGAGAAAAAATGGCTAATTTGATTTATAGCTTGATTAAATCTCATTATAAAGA
TTATTTAAAGAATCCTAATCAGGATTTTGAAGATGCAGTGTGTTCAGATTCAGACGAAGA
GAAAAAGTAAACTGAGAATAATAATAGTAATAGACATAATGCAAATTCTAAATCCAATTC
AGAATGCTCTTCAAAAAATTCTACTAACTTATTTTAAAAACCAACTAATTCCTTTAATTC
TAAACTTTTGAATAGAGAGTACAATAAAGATAAGGATTTTGAGGAAGATATTCCTAAAGA
CTTTAATGGTATAAAAAATACGATAAAAAATTCTAAAAAATAAAAACCTTCAGCTGAAGA
AGAAGAACTCAGTAAAAATAAAGGAACACAAAAAATTATTTCTTTATTGAGTGATTCAGA
ATAATAAGAGTGTAAAATTAATAAAGACAACACTTTGTATAATATCCTCAGTTAATATGT
AAAGCCAGAAACGAAAAGCGATTTATAGAATAAACTAGACAATAAATAAAAGGAAGACAA
TCTAATTGAAAATCTTAAAAATAAATATGAAAATAGCCCTATAAAACTAAAAAGCTTGGA
AACAAATGAATAAAAAAATAATTTAAATGTTAGCAAAAATTAAGAAAACAAAAATGAAGA
TGGCCTTAACATTAATGAGATGGAATTAAATTTTAATGAAAAAGAAGAAGAAGAAGAAAA
TAATGATAATTAGTAATTTAATAAATTTAAAAAAATATTTGATGAAAAATAAGATTATGA
AGATGACGCTTTTAAATTTTAAAATGATATTCTAAATAGCTTCAAGCTTAATAGTAAAAA
TAAATTGTAAAGGTAATAAACTAATTCAAGTAATGGAGGTATGAAAAAAATATAAATTGA
TTCAGATTAAGAATCAACATTACCTTAGAATAAAGAATCATCCTCTTCTTCTAAGAAGTC
TTCAGTAAAACCTTAAAACGGAAATATTTCATTTCTTAGTGAAGAAGAAGATCTTAAAGT
AATATAAACATTATAGGATTCATAAAACAAGAAGAAAAGAAAATTTAACCCAAAAGAATA
CACAAACAATTGGGCTATACTGATATGTCTTTATTGCTTAAAAGAAGAATTTAAAAAGAA
CTCTGCATCTATCAAAGATATAAAACAAAAAGCTAAATCAATATCAGAAGAAATCGATCA
CTAATTTTAAATTAAAAATTTCAACCAAACAGACTCTCTTCTCAACAATGATCTAATTAT
TGTGTATAATTTTATCTAATTTATTCTTAAATTAAAATCAAAAATATAAATATATCCCCT
TTTTCTTTTAGAATATATACTAATTTTATTATGAATTAATCATAACAAATATAAAAATAT
ATATATCAAAATCAATATTCAAGTACAAATAGCAAAAAATCAAAATTTTTAAAAAAATTA
TCTTAAAAATTTATTTTTTTTGAAAATAAAAATTTTTTTATTTTTTTAAATTTCAAAAAA
TTTCATTTGGTTTTTTTAAAATTTAATTTGGTAAATCTGAACTTATAATATCTAATACAT
AATATTGTTAAAAATATTAGATAACTAGTTTAAGGTGAAAAAATATTATCTTTAACAAGC
ACTGGTATTGAATTATCATAGAGTTTATATCACAAGCTTGTTGCTAAATCATTAGCAGGA
ATTTAAGAAAACTCCTAAGAAAATGCAAATAGTTAATAAAAATAATATGATTTAAACTAA
AGTTAAAATTAATCAATAATGGAAGTAGAAGATTAATATGTAGAGTAATATGAAATTAAG
AAAATAGAATCTTAATAACCAAAGAAGATAGAATAATATGAAAAAATGAAACTAGAATAA
TATGAAACAAAGAAAAGAGAAAAATATGATACAGAGGAAATAGATAAAAAACTAAATAAT
TAAAACTCAAGATTATAAAATGAATTTGATGATTACATGGATAAACTTGATTGTGATAGC
AATTTTAATAACATTTTAGATTTTTTAGAAAAATCTGAACAGCCTATTAATTATTCAAGA
TCAAAAACAGCTTTTTTATCTTCTAATCCTGAATCACTAAGTTCTAAGATGGGTAGTATT
TACAATCCTCAAAATAATAAAATAAAATTTGAAAAATTTGAAGAGAATTTTTCTGATAGG
AATTCAGACTACGATGAAAGAATAAAAGAGTTGGATCAATTTAATTCTTAATTTCCCTTA
CCGGTATAAAACTCTAAAAAAAATAAAGGTACAAAGAAAGAAAAAAAAGTTATTGAGCCT
TTATAGTAAAGAAATATTTTCAAAGAATAGAAAATAAAATAACTTTAAGAAATTGAAGAT
GATGATATTGAAAATGAAGCTATAAACAATTCTCTTCCATTTTCTAGTAATCGCTCTATC
CCTAATTAATTATCTCTTGGAATAAAATAATCAAATGTTAGTTAAAAAATTGTAGAAAAA
ATATCTCTTAATAAAATAGCTAAGGGTAAGATTTCTAAAAATATATATTTGCTATTTCTC
TTATTTTAAAATAGGAATGATTAAGGAGTATGAAGTTTATTTGATTATTGATATAAGAGA
AAGAACAGATAAAAACGAAAGAGATTTAGCTATCAAATAAAAATTAGAGGAAAATGGTGT
CTGCTGTAAAATAGAAAATATATATTTAGGTGATTTTTTATGGGTTGTTGATATAACAAG
TAACTTTCAATAAAAAATTGTTTTTTAGAATATTTATTTTTAACCAAAATTCTTCTAAAA
CAGCTATCGATAACGTGACAGAAACTTATGTATTAGACTATGTAGTGGAAAGGAAAACAG
GTGATGATTTTGCTTCAAGTATTTAAGATCACAGATATAAGGAGTAGAAATATAGGTAAT
TTATTTATTTATATTTTATTAGTGTAATGATTGCATAATTAAATTTCCATTAGATATAAG
AAAAGTGGGTTGAAGCATTGTTACTATCTAGTTGAAGGAGATATTAAGAACACTAAGCAT
TTATCAGTGTCATAAAGTGCTATTGAAACGGCAATAATGACTACTTAAATGATTGATAAG
TTTAAAGTGCAGAGAACTAAATCTTTCCAAGAAAGTATGATATGGATCAGTTGTTTGCAT
AAAAATATACTAAAACATTTCAACGAATACATATCAAGCATAAACGATGATCATATTTTA
AATTTTTAGTATACAATGTCAGAATATCAAAAAAATAATAAAAAAAATGGTAATTTAACT
CTTAAAGAATAGTTTGGACATTTTTTAAGATCTATTAATGGATGTGGAGCTTAACAAGTT
TAAGTTCTTACAGAAATCTTTTAGACCCCAATAAATCTAATATCAAATTTAGGAAGTTAA
AGAAATTTACAAGAAAGAATAGAGTTAATAATAGATTAAACAAAATATAATAAGAATTAG
CTAAAAGCATAAGGTATGGATGCAAGGGTTATTTCCAAATCTTTAGCTACTTCAATAGCA
ATTTTATTTGGTGAAGACAAGTATCCTAAAGAAAAATTAGAAGATGGTGCTTGATTAGTC
AATCAGTCAGTCAAATCAATTTAATTAAAAAATATCAAATTTATTAATTAAAATCATTAA
ATTAATTATAATAATAAAATAGTGTGTATTAATTTTAAAAATGTGTCTCTAAATTTTAAT
GGATGCTTAACTTCCTTTAAACTTTTTTTTATGTATAAAATTTTCTTAGATTTAGAGGTT
GGTTGTAGTAAAATAAATCAATAAAACTAGCTCAACTAATTATTTTATTTAAATACTACT
AATTAATATAATATAATTTTTTAATTGCATTCAGAAATGTTAAATTGTTTGTTAATGTAA
GTTAATATATATTCCT