Identifiers and Description

Gene Model Identifier

TTHERM_00660230

Standard Name

MTT5 (MeTalloThionein)

Aliases

PreTt23767 | 98.m00110 | 3736.m00011

Description

Putative metal-inducible metallothionein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF07846 ) Metallothionein family 7

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00660230

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_07831.19.995317835403734e-19metallothionein (114 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:17356700: Díaz S, Amaro F, Rico D, Campos V, Benítez L, Martín-González A, Hamilton EP, Orias E, Gutiérrez JC (2007) Tetrahymena metallothioneins fall into two discrete subfamilies. PloS one 2(3):e291
  2. Ref:17821280: Harrison JA, Fowler EH (1945) AN ANTIGEN-ANTIBODY REACTION WITH TETRAHYMENA WHICH RESULTS IN DYSTOMY. Science (New York, N.Y.) 102(2638):65-6

Sequences

>TTHERM_00660230(coding)
ATGGATAAAATTTCTGGTGAAAGCACTAAAATTTGTAGCAAAACTGAAGAAAAGTGGTGC
TGCTGCCCTAGTGAGACCCAAAATTGCTGCAATTCTGATGATAAATAATGTTGTGTCGGT
TCAGGAGAAGGATGCATATATGTATGCTGCAAGTGTTGTAAGGTTCAAGCTGAATGTAAA
TGCGGACCTAATGCTAAATACTGTTGTATAGATCCCAATACTGGAAACTGTTGTGTTTGT
AAAACTAAATTTTGTAGTAAATCAGATTCTAAAGAATGCTGCCCTGGAGGTAGTTGCTGA


>TTHERM_00660230(protein)
MDKISGESTKICSKTEEKWCCCPSETQNCCNSDDKQCCVGSGEGCIYVCCKCCKVQAECK
CGPNAKYCCIDPNTGNCCVCKTKFCSKSDSKECCPGGSC


>TTHERM_00660230(gene)
ATGGATAAAATTTCTGGTGAAAGCACTAAAATTTGTAGCAAAACTGAAGAAAAGTGGTGC
TGCTGCCCTAGTGAGACCCAAAATTGCTGCAATTCTGATGATAAATAATGTTGTGTCGGT
TCAGGAGAAGGATGCATATATGTATGCTGCAAGTGTTGTAAGGTTCAAGCTGAATGTAAA
TGCGGACCTAATGCTAAATACTGTTGTATAGATCCCAATACTGGAAACTGTTGTGTTTGT
AAAACTAAATTTTGTAGTAAATCAGATTCTAAAGAATGCTGCCCTGGAGGTAGTTGCTGA