Identifiers and Description

Gene Model Identifier

TTHERM_00433530

Standard Name

MTT4 (MeTalloThionein )

Aliases

PreTt26495 | 48.m00258 | 3831.m01596

Description

Copper-inducible metallothionein; similar to MTT2

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00433530

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04190.12.0008536325002377e-42hypothetical protein (165 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:17821280: Harrison JA, Fowler EH (1945) AN ANTIGEN-ANTIBODY REACTION WITH TETRAHYMENA WHICH RESULTS IN DYSTOMY. Science (New York, N.Y.) 102(2638):65-6

Sequences

>TTHERM_00433530(coding)
ATGGACACCCAAACTCAAACTAAGGTCACTGTTGGATGCTCTTGCAACCCTTGCAAATGC
CAACCTCTCTGCAAATGTGGAACTACTGCTGCTTGCAATTGCCAACCTTGCGAAAACTGT
GATCCCTGCTCTTGCAATCCTTGCAAATGTGGTGTTACTGAAAGCTGTGGCTGCAATCCT
TGCAAGTGTGCTGAATGCAAATGTGGATCTCACACTGAAAAGACTTCTGCTTGCAAATGC
AATCCTTGTGCTTGTAATCCTTGCAAATGCGGTTCTACTTCTAACTGTAAATGCAATCCT
TGCAAATGTGCTGAATGCAAATGCTGA


>TTHERM_00433530(protein)
MDTQTQTKVTVGCSCNPCKCQPLCKCGTTAACNCQPCENCDPCSCNPCKCGVTESCGCNP
CKCAECKCGSHTEKTSACKCNPCACNPCKCGSTSNCKCNPCKCAECKC


>TTHERM_00433530(gene)
ATGGACACCCAAACTCAAACTAAGGTCACTGTTGGATGCTCTTGCAACCCTTGCAAATGC
CAACCTCTCTGCAAATGTGGAACTACTGCTGCTTGCAATTGCCAACCTTGCGAAAACTGT
GATCCCTGCTCTTGCAATCCTTGCAAATGTGGTGTTACTGAAAGCTGTGGCTGCAATCCT
TGCAAGTGTGCTGAATGCAAATGTGGATCTCACACTGAAAAGACTTCTGCTTGCAAATGC
AATCCTTGTGCTTGTAATCCTTGCAAATGCGGTTCTACTTCTAACTGTAAATGCAATCCT
TGCAAATGTGCTGAATGCAAATGCTGA