Identifiers and Description

Gene Model Identifier

TTHERM_00241650

Standard Name

MTT3 (MeTalloThionein )

Aliases

PreTt18903 | 20.m00367 | 3706.m00131

Description

Cadmium-inducible metallothionein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF07846 ) Metallothionein family 7
  • ( PF00228 ) Bowman-Birk serine protease inhibitor family

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00241650

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_07832.11.0004783691736523e-35metallothionein (164 aa)
WormBaseWBGene000214960.00010003404299092957status:Partially_confirmed U
niProt:H2L029 protein_id:CCD
71164.2
DictyBaseDDB_G02704880.00020003864201578029DDB_G0270488 on chromosome: 1
position 2594752 to 2606541
OxytrichaContig20746.0.g280.00020003864201578029Domain of unknown function (DU
F4215)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:17356700: Díaz S, Amaro F, Rico D, Campos V, Benítez L, Martín-González A, Hamilton EP, Orias E, Gutiérrez JC (2007) Tetrahymena metallothioneins fall into two discrete subfamilies. PloS one 2(3):e291
  2. Ref:17821280: Harrison JA, Fowler EH (1945) AN ANTIGEN-ANTIBODY REACTION WITH TETRAHYMENA WHICH RESULTS IN DYSTOMY. Science (New York, N.Y.) 102(2638):65-6

Sequences

>TTHERM_00241650(coding)
ATGAGACCTATAATTAAATAATAAATAACAATAATAAAGATAGAATAAAAAAAATATTAG
ACTTAAAAGATGGAAAAAATTAATAACAGTTGCTGTGGTGAAAATACTAAAATCTGCTGC
ACAGACCTAAATAGACAATGTAATTGTGCTTGTAAGACTGATAATTGTTGCAAACCTGAA
ACAAATGAGTGTTGCACTGATACATTAGAAGGATGCAAATGTGTTGATTGTAAGTGCTGC
AAATCTCATGTAACTTGCTGCCATGGAGTTAATGTCAAATCCAGCTGCTTAGATCCAAAT
AGTGGATATTAGTGTGCAAGTAAAACTGATAACTGTTGTAAATCTGATACTAAAGAATGT
TGTACTGGCACTTAAGAAGGATGTAAATGCACTAATTGTTAATGCTACAAACAAGCTTAA
TAAGGATGTTGTTGTGGTGATAAAGCTAAAGCTTGCTGTACTGATCCAAACAGTGGATGT
TGCTGCTCAAATAAGGCAAATAAATGCTGTGATGCCACTTCAAAGAAAGAGTGTCAGGTA
TGTTAATGTTGTAAATGA


>TTHERM_00241650(protein)
MRPIIKQQITIIKIEQKKYQTQKMEKINNSCCGENTKICCTDLNRQCNCACKTDNCCKPE
TNECCTDTLEGCKCVDCKCCKSHVTCCHGVNVKSSCLDPNSGYQCASKTDNCCKSDTKEC
CTGTQEGCKCTNCQCYKQAQQGCCCGDKAKACCTDPNSGCCCSNKANKCCDATSKKECQV
CQCCK


>TTHERM_00241650(gene)
TATATTAAGATTTTTATGAGACCTATAATTAAATAATAAATAACAATAATAAAGATAGAA
TAAAAAAAATATTAGACTTAAAAGATGGAAAAAATTAATAACAGTTGCTGTGGTGAAAAT
ACTAAAATCTGCTGCACAGACCTAAATAGACAATGTAATTGTGCTTGTAAGACTGATAAT
TGTTGCAAACCTGAAACAAATGAGTGTTGCACTGATACATTAGAAGGATGCAAATGTGTT
GATTGTAAGTGCTGCAAATCTCATGTAACTTGCTGCCATGGAGTTAATGTCAAATCCAGC
TGCTTAGATCCAAATAGTGGATATTAGTGTGCAAGTAAAACTGATAACTGTTGTAAATCT
GATACTAAAGAATGTTGTACTGGCACTTAAGAAGGATGTAAATGCACTAATTGTTAATGC
TACAAACAAGCTTAATAAGGATGTTGTTGTGGTGATAAAGCTAAAGCTTGCTGTACTGAT
CCAAACAGTGGATGTTGCTGCTCAAATAAGGCAAATAAATGCTGTGATGCCACTTCAAAG
AAAGAGTGTCAGGTATGTTAATGTTGTAAATGA