Identifiers and Description

Gene Model Identifier

TTHERM_00433520

Standard Name

MTT2 (MeTalloThionein )

Aliases

PreTt26494 | 48.m00257 | 3831.m01595

Description

Copper-inducible metallothionein; identical to MT-2 protein of T. pigmentosa

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 13.9%

TetraMine Data

TTHERM_00433520

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04190.13.998777993244535e-41hypothetical protein (165 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:18068524: Boldrin F, Santovito G, Formigari A, Bisharyan Y, Cassidy-Hanley D, Clark TG, Piccinni E (2008) MTT2, a copper-inducible metallothionein gene from Tetrahymena thermophila. Comparative biochemistry and physiology. Toxicology & pharmacology : CBP 147(2):232-40
  2. Ref:16578928: Kaganman I (2006) Harnessing a tiny hairy beast. Nature methods 3(4):240-1
  3. Ref:14658499: Boldrin F, Santovito G, Negrisolo E, Piccinni E (2003) Cloning and sequencing of four new metallothionein genes from Tetrahymena thermophila and T. pigmentosa: evolutionary relationships in Tetrahymena MT family. Protist 154(3-4):431-42
  4. Ref:17821280: Harrison JA, Fowler EH (1945) AN ANTIGEN-ANTIBODY REACTION WITH TETRAHYMENA WHICH RESULTS IN DYSTOMY. Science (New York, N.Y.) 102(2638):65-6

Sequences

>TTHERM_00433520(coding)
ATGGACACTCAAACTCAAACTAAGGTCACTGTTGGATGCTCTTGCAACCCTTGCAAATGC
CAACCTCTCTGCAAATGTGGAACTACTGCTGCTTGCAATTGCCAACCTTGCGAAAACTGC
GATCCCTGCTCTTGTAATCCCTGCAAATGTGGTGCTACTGAAAGCTGTGGCTGCAATCCT
TGCAAGTGTGCTGAATGCAAATGTGGATCTCACACTGAAAAGACTTCTGCTTGCAAATGC
AATCCTTGTGCTTGTAATCCTTGCAATTGCGGTTCTACTTCCAACTGTAAATGTAATCCT
TGCAAATGTGCTGAATGCAAATGCTGA


>TTHERM_00433520(protein)
MDTQTQTKVTVGCSCNPCKCQPLCKCGTTAACNCQPCENCDPCSCNPCKCGATESCGCNP
CKCAECKCGSHTEKTSACKCNPCACNPCNCGSTSNCKCNPCKCAECKC


>TTHERM_00433520(gene)
ATGGACACTCAAACTCAAACTAAGGTCACTGTTGGATGCTCTTGCAACCCTTGCAAATGC
CAACCTCTCTGCAAATGTGGAACTACTGCTGCTTGCAATTGCCAACCTTGCGAAAACTGC
GATCCCTGCTCTTGTAATCCCTGCAAATGTGGTGCTACTGAAAGCTGTGGCTGCAATCCT
TGCAAGTGTGCTGAATGCAAATGTGGATCTCACACTGAAAAGACTTCTGCTTGCAAATGC
AATCCTTGTGCTTGTAATCCTTGCAATTGCGGTTCTACTTCCAACTGTAAATGTAATCCT
TGCAAATGTGCTGAATGCAAATGCTGA