Identifiers and Description

Gene Model Identifier

TTHERM_00241640

Standard Name

MTT1 (MeTalloThionein 1)

Aliases

PreTt18902 | 20.m00366 | 3706.m00130

Description

Cadmium-inducible metallothionein; mRNA expressed within 10 min of Cd(2+) addition, proportional to Cd(2+) concentration; transcripts disappear upon Cd(2+) withdrawal

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF07846 ) Metallothionein family 7

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.9%

TetraMine Data

TTHERM_00241640

WebApollo

Fullscreen View

Tetrahymena Stock Center

  • ( SD01419 ) Macronucleus: Neo coding replaces MTT1 coding of some of MTT1 copies, both present

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_07831.11.000499495426459e-47metallothionein (114 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:18068524: Boldrin F, Santovito G, Formigari A, Bisharyan Y, Cassidy-Hanley D, Clark TG, Piccinni E (2008) MTT2, a copper-inducible metallothionein gene from Tetrahymena thermophila. Comparative biochemistry and physiology. Toxicology & pharmacology : CBP 147(2):232-40
  2. Ref:16467482: Boldrin F, Santovito G, Gaertig J, Wloga D, Cassidy-Hanley D, Clark TG, Piccinni E (2006) Metallothionein gene from Tetrahymena thermophila with a copper-inducible-repressible promoter. Eukaryotic cell 5(2):422-5
  3. Ref:14658499: Boldrin F, Santovito G, Negrisolo E, Piccinni E (2003) Cloning and sequencing of four new metallothionein genes from Tetrahymena thermophila and T. pigmentosa: evolutionary relationships in Tetrahymena MT family. Protist 154(3-4):431-42
  4. Ref:11891286: Shang Y, Song X, Bowen J, Corstanje R, Gao Y, Gaertig J, Gorovsky MA (2002) A robust inducible-repressible promoter greatly facilitates gene knockouts, conditional expression, and overexpression of homologous and heterologous genes in Tetrahymena thermophila. Proceedings of the National Academy of Sciences of the United States of America 99(6):3734-9
  5. Ref:9243804: Hegyesi H, Csaba G (1997) Time- and concentration-dependence of the growth-promoting activity of insulin and histamine in Tetrahymena. Application of the MTT-method for the determination of cell proliferation in a protozoan model. Cell biology international 21(5):289-93

Sequences

>TTHERM_00241640(coding)
ATGGATAAAGTTAATAGCTGTTGCTGTGGTGTAAATGCTAAGCCATGCTGCACAGACCCT
AACAGCGGATGTTGCTGCGTAAGTAAGACTGATAATTGCTGCAAATCTGACACAAAGGAA
TGTTGCACTGGTACAGGAGAGGGATGCAAATGTGTTAATTGCAAGTGCTGCAAACCTCAA
GCAAATTGTTGCTGTGGAGTTAATGCTAAACCCTGCTGCTTTGATCCCAATAGTGGATGT
TGCTGTGTTAGTAAAACTAATAACTGTTGTAAATCTGATACTAAAGAATGCTGTACTGGT
ACTGGAGAAGGATGCAAATGTACAAGTTGCTAATGCTGCAAACCTGTTTAATAAGGATGT
TGTTGTGGTGATAAAGCTAAGGCTTGCTGTACTGATCCAAACAGTGGATGTTGCTGCTCA
AATAAGGCAAATAAATGCTGTGATGCTACTTCAAAGCAAGAGTGTTAGACTTGTTAATGT
TGTAAATGA


>TTHERM_00241640(protein)
MDKVNSCCCGVNAKPCCTDPNSGCCCVSKTDNCCKSDTKECCTGTGEGCKCVNCKCCKPQ
ANCCCGVNAKPCCFDPNSGCCCVSKTNNCCKSDTKECCTGTGEGCKCTSCQCCKPVQQGC
CCGDKAKACCTDPNSGCCCSNKANKCCDATSKQECQTCQCCK


>TTHERM_00241640(gene)
ATGGATAAAGTTAATAGCTGTTGCTGTGGTGTAAATGCTAAGCCATGCTGCACAGACCCT
AACAGCGGATGTTGCTGCGTAAGTAAGACTGATAATTGCTGCAAATCTGACACAAAGGAA
TGTTGCACTGGTACAGGAGAGGGATGCAAATGTGTTAATTGCAAGTGCTGCAAACCTCAA
GCAAATTGTTGCTGTGGAGTTAATGCTAAACCCTGCTGCTTTGATCCCAATAGTGGATGT
TGCTGTGTTAGTAAAACTAATAACTGTTGTAAATCTGATACTAAAGAATGCTGTACTGGT
ACTGGAGAAGGATGCAAATGTACAAGTTGCTAATGCTGCAAACCTGTTTAATAAGGATGT
TGTTGTGGTGATAAAGCTAAGGCTTGCTGTACTGATCCAAACAGTGGATGTTGCTGCTCA
AATAAGGCAAATAAATGCTGTGATGCTACTTCAAAGCAAGAGTGTTAGACTTGTTAATGT
TGTAAATGA