Identifiers and Description

Gene Model Identifier

TTHERM_00332190

Standard Name

MTP1 (Membrane Transport Protein 1)

Aliases

PreTt30326 | 33.m00338 | 3705.m00162

Description

BT1 family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF03092 ) BT1 family
  • ( PF03209 ) PUCC protein
  • ( TIGR00900 ) H+ Antiporter protein
  • ( TIGR00901 ) AmpG-related permease
  • ( TIGR00788 ) folate/biopterin transporter
  • ( TIGR00880 ) Multidrug resistance protein
  • ( PF04018 ) Domain of unknown function (DUF368)
  • ( PF07690 ) transporter, major facilitator family
  • ( TIGR02718 ) siderophore transporter, RhtX/FptX family
  • ( TIGR00881 ) phosphoglycerate transporter family protein
  • ( TIGR00895 ) MFS transporter, aromatic acid:H+ symporter
  • ( TIGR02185 ) conserved hypothetical integral membrane protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00332190

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20852.19.997093137033517e-262B.2 family protein (526 aa)
OxytrichaContig261.1.g309.996907204735647e-62BT1 family
Stentor CoeruleusSteCoe_201383.817497188671175e-54

General Information

Paragraph NoGene NameParagraph Text
41MTP1Two domains on Tetrahymena thermophila MTP1 suggest that it belongs to the BT1 family. The proteins of this family are transport proteins, suggesting that MTP1 is also a transporter. Many proteins of this family are thought to be pteridine transporters, so it is possible that MTP1 also transports pteridine. By Nicole Hohnstein and Emilie Fisher, undergraduates at the Keck Science Department of Claremont McKenna, Pitzer, and Scripps Colleges.

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00332190(coding)
ATGAAATAAGCATTTAGCTCTGGCAAGAATAAAATCTTATAGATTTATTAAAAAATGAAA
GAAAATGTGCTATCAGATAATTTCTCATCATACTTAGTATTAGGTGTTGTAGCATTTACT
TCTGGTATTATGGGTTTATCAGATTTAGCAATTAGTTATCTTTACAAAGATGATTATAAA
ATGAGTCCATCTCAAGTTTCACTAGCTTAAAGTATAGTAACTCTTCCTTGGATTTTCAAA
CCAATATGGGGTTTAACTTCTGATTGCATTCCTTTTATGCAATATAGAAGAAAATCATAT
TTGATTTTGTGTGGGCTAATTTCATTTGTTATGTGGTCGTTGATGGCCTATTAAATAAGA
TAAAAATTTTTAGGTTTTGGAGCTCTATTTATAATTCAATTTTGTGGATCATTTTGTAGT
GTTATTGCAGAGGCAATTGTAGTAGAAATTTCACAAAAAAGAGCCAGAGCTAATACTGAT
TGGACTGAAGAGTAACAACAAGCTGAAGCAGCCAAAAACGTTTCTCTTTTTTTTGGTATT
AGAAGCTGTGGTGCTTTAGTAGTTGCTTATCTAGGAGGTCATCTTCTTGAAATTTTTTCT
AAATATACGATTTTTGCGATTACAAGCTGCTTTCCATTAATGATTGTAGTTTCGTCATTC
TTTTTAGATGAAGAAAAAACAATAAATAATACTACTTTGGTTGAAACAACTAAATATTAG
ATTAGATAATTTTGGGTTTTTATAAGTAAACCAGCTATTTATAAACCTATTCTGTATATA
TTAGCTTTTATGATGATGCCTTGCAGTGGTTCTGCTATGTTCTTTTTTTATACAAATGTG
TTGGGTTTTTAGCCTGAATTTTTAGGGTAATTGAGATTTATATATGCTTCAGGCTCTATT
TTTGCTACCTTAATGTATAATAAATATTTAAAGAGTGTTCCCTTTAAAAAACAGTTCACA
TACAGTACAATTGTAAGCTCAATATTTGGCTTAACTTAGATTTTACTTGTTACAAGAGCT
AATTAAAGATTAGGAATCCCAGATAAAGTATTTACAGTAAGTGACAGCATTATGCTTCAA
ATTGTAGGTGAATTTAACTTAATTCCTATTTTAGTAATGGCATGCAGACTGTGCCCTAAA
GATATTGAAGGAACTATGTATGCTTTATTAATGTCTACTTTAAATTTTGGAGGAATTATG
AGTGAGCAACTTGGTGGTTTATTAACTTATTCTTTTGGAATTAGTGAAACAAACTTTGAC
AATCTTTGGATTCTTGTTTTAATTACCAATCTTTTACAATTAACTCCTTTGATATACTTA
AATAAGATTGATATCAATAAAGCTTAGGAAATTACTGGTTCGACCCACTAATAATAAGAT
TCTTAAGACGAAGAAAAAATTGAAGCTAAATAAAACACAAGTGAATCAGAATAGTTTTAA
GATGATGATAATGAAGTTAAAAAATGTGTTAATAATTAAGTTAATAATACTGTTTAAAAT
GAGGAAGACAGGTTATGTGAATAGTCTGATTAAGATTATGGCTTAAGTTAGTCAGAGTAG
GTATAAATCAATAACCAAATTGAATAATATATTGAACATTATTCAGGATTTTGA


>TTHERM_00332190(protein)
MKQAFSSGKNKILQIYQKMKENVLSDNFSSYLVLGVVAFTSGIMGLSDLAISYLYKDDYK
MSPSQVSLAQSIVTLPWIFKPIWGLTSDCIPFMQYRRKSYLILCGLISFVMWSLMAYQIR
QKFLGFGALFIIQFCGSFCSVIAEAIVVEISQKRARANTDWTEEQQQAEAAKNVSLFFGI
RSCGALVVAYLGGHLLEIFSKYTIFAITSCFPLMIVVSSFFLDEEKTINNTTLVETTKYQ
IRQFWVFISKPAIYKPILYILAFMMMPCSGSAMFFFYTNVLGFQPEFLGQLRFIYASGSI
FATLMYNKYLKSVPFKKQFTYSTIVSSIFGLTQILLVTRANQRLGIPDKVFTVSDSIMLQ
IVGEFNLIPILVMACRLCPKDIEGTMYALLMSTLNFGGIMSEQLGGLLTYSFGISETNFD
NLWILVLITNLLQLTPLIYLNKIDINKAQEITGSTHQQQDSQDEEKIEAKQNTSESEQFQ
DDDNEVKKCVNNQVNNTVQNEEDRLCEQSDQDYGLSQSEQVQINNQIEQYIEHYSGF


>TTHERM_00332190(gene)
ATGAAATAAGCATTTAGCTCTGGCAAGAATAAAATCTTATAGATTTATTAAAAAATGAAA
GAGTATTTATTTATTGTTTACTTTAACAGATTATTTTAATTCAATTATTGATATTTTAGA
AATGTGCTATCAGATAATTTCTCATCATACTTAGTATTAGGTGTTGTAGCATTTACTTCT
GGTAAAATTATTTTGCATAATTATTTCAAAAGATGATAGATAAAATTGGCATTCTTTCTA
TTCTTAATTTTAATAATATAGGTATTATGGGTTTATCAGATTTAGCAATTAGTTATCTTT
ACAAAGATGATTATAAAATGAGTCCATCTCAAGTTTCACTAGCTTAAAGTATAGTAACTC
TTCCTTGGATTTTCAAACCAATATGGGGTTTAACTTCTGATTGCATTCCTTTTATGCAAT
ATAGAAGAAAATCATATTTGATTTTGTGTGGGCTAATTTCATTTGTTATGTGGTCGTTGA
TGGCCTATTAAATAAGATAAAAATTTTTAGGTTTTGGAGCTCTATTTATAATTCAATTTT
GTGGATCATTTTGTAGTGTTATTGCAGGTAATAAAAAATAAATTAGATTTATTATTTAAT
AGACTGATTTTTTCAACAAATTTATATTTAATACATTTTATAATAATAAAAATTATAATG
ATAAAAAAATAGAGGCAATTGTAGTAGAAATTTCACAAAAAAGAGCCAGAGCTAATACTG
ATTGGACTGAAGAGTAACAACAAGCTGAAGCAGCCAAAAACGTTTCTCTTTTTTTTGGTA
TTAGAAGCTGTGGTGCTTTAGTAGTTGCTTATCTAGGAGGTCATCTTCTTGAAATTTTTT
CTAAATATACGAGTAATTTAATTAAAAATTTTTTTAAAAATATTTATTTAAATAATAAAT
AAATTTCAACACCTGGCTTTCAAATTTTTTAATTTTACTTTATTTTATGAAATAGTTTTT
GCGATTACAAGCTGCTTTCCATTAATGATTGTAGTTTCGTCATTCTTTTTAGATGAAGAA
AAAACAATAAATAATACTACTTTGGTTGAAACAACTAAATATTAGATTAGATAATTTTGG
GTTTTTATAAGTAAACCAGCTATTTATAAACCTATTCTGTATATATTAGCTTTTATGATG
ATGCCTTGCAGTGGTTCTGCTATGTTCTTTTTTTATACAAATGTGTTGGGTTTTTAGCCT
GAATTTTTAGGGTAATTGAGATTTATATATGCTTCAGGCTCTATTTTTGCTACCTTAATG
TATAATAAATATTTAAAGAGTGTTCCCTTTAAAAAACAGTTCACATACAGTACAATTGTA
AGCTCAATATTTGGCTTAACTTAGATTTTACTTGTTACAAGGTAAGTTTTCTTCAAATTT
CTTTTAGTATTATTAACCAATAATTAATTTTTTAGAATCATATTATTAAACCAAAAAATA
ATTGATATTCAATTTTTAATAATATAAAAAAGTTAATATTTTTATTTTTTAAAAAAATAG
AGCTAATTAAAGATTAGGAATCCCAGATAAAGTATTTACAGTAAGTGACAGCATTATGCT
TCAAATTGTAGGTGAATTTAACTTAATTCCTATTTTAGTAATGGCATGCAGACTGTGCCC
TAAAGATATTGAAGGAACTATGTATGCTTTATTAATGTCTACTTTAAATTTTGGAGGAAT
TATGAGTGAGCAACTTGGTGGTTTATTAACTTATTCTTTTGGAATTAGTGAAACAAACTT
TGACAATCTTTGGATTCTTGTTTTAATTACCAATCTTTTACAATTAACTCCTTTGATATA
CTTAAATAAGATTGATATCAATAAAGCTTAGGAAATTACTGGTTCGACCCACTAATAATA
AGATTCTTAAGACGAAGAAAAAATTGAAGCTAAATAAAACACAAGTGAATCAGAATAGTT
TTAAGATGATGATAATGAAGTTAAAAAATGTGTTAATAATTAAGTTAATAATACTGTTTA
AAATGAGGAAGACAGGTTATGTGAATAGTCTGATTAAGATTATGGCTTAAGTTAGTCAGA
GTAGGTATAAATCAATAACCAAATTGAATAATATATTGAACATTATTCAGGATTTTGA