Identifiers and Description

Gene Model Identifier

TTHERM_01087820

Standard Name

MTB6 (Mating type gene)

Aliases

PreTt05183 | 227.m00039

Description

Required for Mating type recognition.

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF01500 ) Keratin, high sulfur B2 protein
  • ( TIGR03058 ) chlorosome envelope protein H

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: Yes
Presense Probability: 84%

TetraMine Data

TTHERM_01087820

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_41346.14.999878681532552e-93hypothetical protein (1657 aa)
OxytrichaContig21584.0.1.g1010.00000030014504373857585hypothetical protein

General Information

Paragraph NoGene NameParagraph Text
94MTB6The germline MAT locus was discovered in 1953 and remains the only known Mating type locus in T. thermophila. The mat-1-like allele codes for mating type I,II,III,V,VI. The MTA and MTB genes determine mating type.These genes code for trans-membrane proteins that may localize to the cell surface. The proteins may play a role in self/non-self recognition, since cell-cell contact is required to stimulate cells for mating. The MTA6 and MTB6 genes have been shown to be necessary for mating type recognition, but may also play a role in cell-cell recognition during mating.

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01087820(coding)
ATGCAAGTATATACCTTAGTGTTTGTTCTTATTCTGCTGATTCGAAAGAACTCAGCTCAG
ACAATTTGCTATCAAATAAGTGCTGATAAGAATTTGAAGTAAATCTAGCAATTACCTCTC
AATTAAAGACTAGAGTTTTACAATAAAATACCTAATTATAATTTTGCTTTAGATTTCAGC
ATAAACAATTCAGACTTTCTGGCTAACTATCCTCCCAGTTTATTTTTTACATATTTGTTC
ATAACTACTTCCAACAAATAAGTATTAGATAAATTTACTACTTTTCCATCAATCCAATAG
ATTTAACAAAACTATGGAAACCAAGCTTTTTACATCACTTTAGTTTTCGATTCGTCAAGT
TTTTAGCAAGCGATTGATTCTTAGGCACTTCAAGCCTACAGTTCAATCACTTTCTTTCCT
ATGCTAACCCTTCCAATCTTTGTGCAGATAAACTCCTAGAGCTAGCAATTAATGATTTCA
AGTACTTTAATATCTTAGATTAACGATGTATCCACTCTAGTCTTACTCTATCCTACTTCA
TTTGCTTCGCAGCCATAAAACAGCAATAATTTAGGGTGCCAGCTTTATACTGATTTTGTT
AGTATAAATTAATGCTCTTTTGCAACTAATTCGTCTTCAGGTTTAAGTAGTATTAGCTTT
AACTTATCTGGCTAGAATGTTTCTTTATAAAATATCTCTGCAACAATAGTCCTCAATTCA
ACTACATTTATCTAAAATAAATTATCAACAGTAAAATTTCAAATGCAATTACTTAATTAC
TACTAATCTTAGATAGCTCAATCTCCATTATTCGCTATTTAAGATTAAAGAAAGTGCTAA
CAAACAACAAGCTTTTCTGCAAATCTTATTGACAATACCATGCAATTCTTGTAAATGAAA
AGACTCTAGGTGAGTTTTACTCCTGCCACACAAAAAATTACAAGATTAATGATAGATTTC
CTGTAATAAGTTAATGTCAAAACAAATTCATCAAATATTGTGTTGATACTTTCAGATACA
TCTCAAGCAAATTCTTTTGTAATATTCTGTAATAAGGTCTATCAATCTCTAGTACTTTGC
GACTTGACTAATTATTAACTTTTTGATTTTACAAAAGGAATTTTGATAACTCTTCCATAC
TTCTAAACTGTCTAGCAAGTGCAATAACCAACTTTCTCTTTCCAGATAATTTACTATGGA
GATCTAAGTTATTCTAATTGCTATGTCACTACCCTCACAGTACAATATTTGCCAATCCCT
TCTTTATTTTCACCAATCGCTTATCTATACAGTAATAATACCTTACAAATGTCTCTCTTT
GATAAACTAAGTCTAGATAGTTCAATGTTCATTTAAATTCAGTTACCTAATTTGCTTAGT
TTTTCTTAAACTACTTAACTTGGAAATACTTCAGGGATTAGCAATCTCTCAAAGATCTCT
GTATAATCTCAGTAAAAAGCCCAATTGTCTTAGATTAATTAATCTATTTAAAGCATATAA
TCAGGAATATCATTTTCATTCACTAATGTTTAGTAAATTAATACTGAATGTAATTATAAT
TCTACAAATTTAGTTAGAATACAAATAACCAACACTCAAGGATTATTGATTTACAATATA
ACGGCAGCACTCTAAATTTAGCCTAAACAGATTAACATTGTATCAATAAACACAATCTAC
TTAACACCGGATTCATAATCATAGTCACAACAGCTAAATTAATACTTTAATGTCTCAATG
ACTACTCTTGAAATAAACTTTCAACTTTAATCCAGCTACTACCCATAATAATCAGCATTT
ATGATTTATATGCCTCCTCAGCTATCAAGAGATAGTAGAATAAGCAATGTTTCAGTTGAT
ATATCTAATGAATTTCTTAATTATTGCAAAATTCAAACTAATTCTACATAAATTTCAAAT
TAAACTGTAAATTACTAAAACAAAATTTAATAGAGAGAAGTAATTTCTATTATTTGCTAA
TAAAGTGGAAACACAAATACTTAAAGTGTTTTTACTGTAACAATCTAAGGCTATCAATTA
CCAAGATAATTATAAAAACCAACAGATAGACTTATTATTGATTTAATTGACTTTTCTTAA
AAGCAAAATCAGCCTTTGCCTCTATGCCTTACAACAGAAAATCCTGATATCTCAAATTAA
GTTAAAAGTAGTTGGGTTTTTACAAATACTAAATAAACTAGCTTTTTTGTTTCACAATAT
GATTTTAAATTTAACGGTAGCTCTGACTAAAATACATTAACCCTTCAGTCTTTGTTAAAT
ATGACAACGTATTACAATATTAGTGATGGAGACTTATTGTTCATATCCTTTTCAAAAATG
AACTTTTTTAAAATAGAAACTTTAAATGGAAAATTACTTCCAAATTAAAATTCTACTGAA
AATAAAGATTTAAATTGTTCTTTGGTTTATCCTTAATCAAGCGCATAATCTTCTGCTTTA
TCTTAGTGCATTTTATTAGAAACCCCTTCAAACTACTCAATTTAAATTACTCTTAAAACA
GCTAATTTGAATTCAATAAGTGGTTGGAATAGCAAAGATATCTTTATAACAATAAATTCA
TTAGCGTTTTAGTAACTCCTTCCATCTAATAATACTAAAATTTAGTTTACGCACTTCTCA
AGTGATCAATATTTGTTAAGCTAATCTAATTATTTATTAAATAGCCAGTAAACAACTTCA
AATGTATTTTACTCAATAAATTAAATAAGTTCTGTCACTCAGTAAACAATAACTAGCTTT
GTCTAAACAATTAAATTTGATTTTATTAAAATTTAATTTTTAATGTAAACCTTAATGTCT
ACTTTAGATTCTGGATTAAATTTAGCTATAAACTTTTCATAACAAGTCTATTTTAATGTT
CAAACATTTTGTTCTTTGGATAATATTTGCTCTTAGAGTAGTCATCAAATAAAATGCAGT
GTCTCTTCTGACGGATTTACTATCCTACTTAGTTAAATTGATTAAAATGCCTTTTGTTCT
CCACCTGTTTTGACTAACTTTAATATCACAATTCATAATCCTGAAATAAATAACTAAAAT
TCAACAGGAGGTGCTGCTTAATCAATAGCAATTAATTGGAATTTAACAAGCACTACAAGC
TCTTAAACTCTTTTGTCGGGACACACTTCATTAACTACCAACACCTCCTAATGTCCTTAA
CCTCACTGCGCCACTTGCACATCTCCTCCATCCATTTGCATTCACTGCACCCAAGGCTAT
TATTTACTTCCAGATCAAAACTCATGCGTCCAGACTTGTCCACCTCCAACAGTCGCTCAT
CAACAAACAGCTACTTGCCAGCCATGCTTCCAGCACCAAGAGTGTCTTCAATGCCAGTCT
CAAAACCCAGCTGCTTGCACCTCATGTTCTCCCACCTATTCCCTCAATTCCACTCTCCTC
CCCTATTGCTACGTGCCTCTTCCTCCTTCTAGTAGCGCTTCTTCCTCCGTCACCAAGGAT
GTTGTCAATCGCACGCCTTCTAACTCAACCTTTTCAGGAGCACTCAATCGACCTGAGCCA
GGACAGCCCTCACAAAAGTAGCAGTAGCAGTAGTAGTAGTAGTAGCAGCAGGAGCAGCAG
CAACAACAAGAACAACAACAGCAGGAGGCCCAAGCTAGCGATCAGCGAGGCTTTGCTCAT
TTCTTAGCTCAAACCAAGTCTTATACGAAAGGCTTTATTTTGACACTGCTGATTCCCCTC
TCAATACTCGGTGCTTGCCTCACTAGGCTAGTCACCTTTTGTCTGAAAAAGCGAGAAAAG
AAGGTGCATCCACCACTGCCTAGTGAATCGAGGAGTGCACAGATTGCACAAAACTTGGAT
GAAAGGTAAGAAACACAAAAAGATGGAAATGGTGGCGATGAAGAACAGATGAGAGCGTCT
TCGAGGGTAGACACAGCAAATATGTGTCCTCTGAACTCAAGAAGAGGCGAGTAGTTATAA
TTGGAAGGTGTGCAGTAATAAAGCGATGGTGGTGTTGGTGGTGGGGAAAGTGAAGGAAAC
GGGTATTTAGCGTTCTGCTGGATAGCAGTGATCCTTTTGTTGGGAAATGTGGGTGATTTA
GTAGAGGTGCCTTATATTATCTTCTCACAGTAGAACTCGTTTTCTAACAAAAGCACAACA
AATGTATTTGACTTGTAATTTTCAGAAGCAGACATGGGCTAGATTTGTTGTTTGAGCTAC
ATCGCACTAAACGCAGTTTGCTACTTGATCTGCGTCGTAATGATGGTAAAGGCTATAATT
TTTGAGACTGGAAGTGGTGAGCCTCTGTTTTGTATTTACGAAGTGAAGCTGAGTAGCAGT
AGCAGTTTTTGTGGAGAAGAAATGAAGAAGGATAAAAGTGAAGCTGCTGCGTGCAAAGGG
GATTCGAATGCTTAGAATGAGAATGGAGAGAAGCACAAAAAAGTGTTGAGTGGGCGAAAG
CTATGGAAGCTAATAATAGATGTTTTCTTGAGATGTCTGGTAGTTGTTGGTGGAAAAGCT
TTCTGCATGGTTTATTCAAACGTGGCAAATGTAAAGGGATGGTTAACATGCTAAGTAGAT
AAAAATTTGAGAGCATTTAGATTGTTCTATATGACTTTGTGCATCCATGCAATCTTCAAT
ATGATATCAGCAGTATTCTTTACTCTCATGCTTACTCATTTCTCCTTTGCTTCTTGGACT
GCAGTAGCACAAGATAGCCTTACAAGCTAAGGTAGCGATGGTGGAGTCGAATTTTCGTTC
TTTGTTGACATCCTTGCATTTAAATTTTTAATGTCTCTGATTTGTTTTTTGAACTGCCTG
CATATCTAACAGCTAATTAGTGCCTGCAAATCTCCTAATCTTCCTGGACCCTAAAATCCC
GTTTCCCATCGACTCTAAAGCCCATCTACTCCTTCTTCTTCCGCATCACCTGCAGACGCA
GTAGAAAGAGACGCTTGCAAAGTTTCATACTTTGAAAATACACCAAATGCTGCTGAAAAG
ACTACTCCAACTGCGGTAACGCTTGCCTCTTATCGCCAGCAAGAAACATCAGGAACTGGT
TCTTAAAACCTCATAGAAGGTAGACCAAGGAGAAAAAAACCATCAAAGTTGAGTCTATTG
CTAAAAAGAGATTCAGGATAAAAATCTGGTAGTTCACTTTCATCTAGACAGCAAGAAACA
CCTTCGCCAAATTTGCCTTCCTACTCTCCTAATCTCTACCCATCTCAAGCATACATTTGA


>TTHERM_01087820(protein)
MQVYTLVFVLILLIRKNSAQTICYQISADKNLKQIQQLPLNQRLEFYNKIPNYNFALDFS
INNSDFLANYPPSLFFTYLFITTSNKQVLDKFTTFPSIQQIQQNYGNQAFYITLVFDSSS
FQQAIDSQALQAYSSITFFPMLTLPIFVQINSQSQQLMISSTLISQINDVSTLVLLYPTS
FASQPQNSNNLGCQLYTDFVSINQCSFATNSSSGLSSISFNLSGQNVSLQNISATIVLNS
TTFIQNKLSTVKFQMQLLNYYQSQIAQSPLFAIQDQRKCQQTTSFSANLIDNTMQFLQMK
RLQVSFTPATQKITRLMIDFLQQVNVKTNSSNIVLILSDTSQANSFVIFCNKVYQSLVLC
DLTNYQLFDFTKGILITLPYFQTVQQVQQPTFSFQIIYYGDLSYSNCYVTTLTVQYLPIP
SLFSPIAYLYSNNTLQMSLFDKLSLDSSMFIQIQLPNLLSFSQTTQLGNTSGISNLSKIS
VQSQQKAQLSQINQSIQSIQSGISFSFTNVQQINTECNYNSTNLVRIQITNTQGLLIYNI
TAALQIQPKQINIVSINTIYLTPDSQSQSQQLNQYFNVSMTTLEINFQLQSSYYPQQSAF
MIYMPPQLSRDSRISNVSVDISNEFLNYCKIQTNSTQISNQTVNYQNKIQQREVISIICQ
QSGNTNTQSVFTVTIQGYQLPRQLQKPTDRLIIDLIDFSQKQNQPLPLCLTTENPDISNQ
VKSSWVFTNTKQTSFFVSQYDFKFNGSSDQNTLTLQSLLNMTTYYNISDGDLLFISFSKM
NFFKIETLNGKLLPNQNSTENKDLNCSLVYPQSSAQSSALSQCILLETPSNYSIQITLKT
ANLNSISGWNSKDIFITINSLAFQQLLPSNNTKIQFTHFSSDQYLLSQSNYLLNSQQTTS
NVFYSINQISSVTQQTITSFVQTIKFDFIKIQFLMQTLMSTLDSGLNLAINFSQQVYFNV
QTFCSLDNICSQSSHQIKCSVSSDGFTILLSQIDQNAFCSPPVLTNFNITIHNPEINNQN
STGGAAQSIAINWNLTSTTSSQTLLSGHTSLTTNTSQCPQPHCATCTSPPSICIHCTQGY
YLLPDQNSCVQTCPPPTVAHQQTATCQPCFQHQECLQCQSQNPAACTSCSPTYSLNSTLL
PYCYVPLPPSSSASSSVTKDVVNRTPSNSTFSGALNRPEPGQPSQKQQQQQQQQQQQEQQ
QQQEQQQQEAQASDQRGFAHFLAQTKSYTKGFILTLLIPLSILGACLTRLVTFCLKKREK
KVHPPLPSESRSAQIAQNLDERQETQKDGNGGDEEQMRASSRVDTANMCPLNSRRGEQLQ
LEGVQQQSDGGVGGGESEGNGYLAFCWIAVILLLGNVGDLVEVPYIIFSQQNSFSNKSTT
NVFDLQFSEADMGQICCLSYIALNAVCYLICVVMMVKAIIFETGSGEPLFCIYEVKLSSS
SSFCGEEMKKDKSEAAACKGDSNAQNENGEKHKKVLSGRKLWKLIIDVFLRCLVVVGGKA
FCMVYSNVANVKGWLTCQVDKNLRAFRLFYMTLCIHAIFNMISAVFFTLMLTHFSFASWT
AVAQDSLTSQGSDGGVEFSFFVDILAFKFLMSLICFLNCLHIQQLISACKSPNLPGPQNP
VSHRLQSPSTPSSSASPADAVERDACKVSYFENTPNAAEKTTPTAVTLASYRQQETSGTG
SQNLIEGRPRRKKPSKLSLLLKRDSGQKSGSSLSSRQQETPSPNLPSYSPNLYPSQAYI


>TTHERM_01087820(gene)
ATGCAAGTATATACCTTAGTGTTTGTTCTTATTCTGCTGATTCGAAAGAACTCAGCTCAG
ACAATTTGCTATCAAATAAGTGCTGATAAGAATTTGAAGTAAATCTAGCAATTACCTCTC
AATTAAAGACTAGAGTTTTACAATAAAATACCTAATTATAATTTTGCTTTAGATTTCAGC
ATAAACAATTCAGACTTTCTGGCTAACTATCCTCCCAGTTTATTTTTTACATATTTGTTC
ATAACTACTTCCAACAAATAAGTATTAGATAAATTTACTACTTTTCCATCAATCCAATAG
ATTTAACAAAACTATGGAAACCAAGCTTTTTACATCACTTTAGTTTTCGATTCGTCAAGT
TTTTAGCAAGCGATTGATTCTTAGGCACTTCAAGCCTACAGTTCAATCACTTTCTTTCCT
ATGCTAACCCTTCCAAGTAAAATTTTAATTTATTCAATTCTTTCTTTTCATTTTTTATAT
TTTCAATAGTCTTTGTGCAGATAAACTCCTAGAGCTAGCAATTAATGATTTCAAGTACTT
TAATATCTTAGATTAACGATGTATCCACTCTAGTCTTACTCTATCCTACTTCATTTGCTT
CGCAGCCATAAAACAGCAATAATTTAGGGTGCCAGCTTTATACTGATTTTGTAATTTGCA
AATTTTATTTAAAACTCATTTTTTTGTTTGTTTACTTGCATCAATATAGCTGTTAATTAA
CAATACAAAAAATAATAATAAATCAATTAATCTATTTGAAATTAAAACAAATTATTTCAC
ATAATTTGCTTAAAATTTTACCTATTTATTAGTAATATAGGAAATATATTAAAAAACTTA
GTTAATTTAATTATTTAATCAATATATTTAACATTTTAATCAAGAATTAATTTTATAAAT
TAGGTTAGTATAAATTAATGCTCTTTTGCAACTAATTCGTCTTCAGGTTTAAGTAGTATT
AGCTTTAACTTATCTGGCTAGAATGTTTCTTTATAAAATATCTCTGCAACAATAGTCCTC
AATTCAACTACATTTATCTAAAATAAATTATCAACAGTAAAATTTCAAATGCAATTACTT
AATTACTACTAATCTTAGATAGCTCAATCTCCATTATTCGCTATTTAAGATTAAAGAAAG
TGCTAACAAACAACAAGCTTTTCTGCAAATCTTATTGACAATACCATGCAATTCTTGTAA
ATGAAAAGACTCTAGGTGAGTTTTACTCCTGCCACACAAAAAATTACAAGATTAATGATA
GATTTCCTGTAATAAGTTAATGTCAAAACAAGTAAAATTTATTCAGCTTTATTATTATTT
TATATAATTAACTATTCAATCAGATTCATCAAATATTGTGTTGATACTTTCAGATACATC
TCAAGCAAATTCTTTTGTAATATTCTGTAATAAGGTCTATCAATCTCTAGTACTTTGCGA
CTTGACTAATTATTAACTTTTTGATTTTACAAAAGGAATTTTGATAACTCTTCCATACTT
CTAAACTGTCTAGCAAGTGCAATAACCAACTTTCTCTTTCCAGATAATTTACTATGGAGA
TCTAAGTTATTCTAATTGCTATGTCACTACCCTCACAGTACAATATTTGCCAATCCCTTC
TTTATTTTCACCAATCGCTTATCTATACAGTAATAATACCTTACAAATGTCTCTCTTTGA
TAAACTAAGTCTAGATAGTTCAAGTAAATAAATATTTAGAACTTATTCATTTATTTATCT
TTCTCTTTTAAAATATTAAAATTCTTTGAGTCTAATTTACCTAAAAAGAAAATAAATTCA
AAAATTATTTTATTATTTTTTAATTTATCGCAGATTATTTTCAAAAAACAATATAAAAAA
AATAAAAAACTTATAAATTTCAAAACAAATTCTTTTAATTGCTAAAAATAAATATTAAAA
TTTATCAATAGTGTTCATTTAAATTCAGTTACCTAATTTGCTTAGTTTTTCTTAAACTAC
TTAACTTGGAAATACTTCAGGGATTAGCAATCTCTCAAAGATCTCTGTATAATCTCAGTA
AAAAGCCCAATTGTCTTAGATTAATTAATCTATTTAAAGCATATAATCAGGAATATCATT
TTCATTCACTAATGTAAAATAAAAGTTAAATTAATACATATAAATTAAATTAACTTTATT
TATTTTTAAATTTTAATTAGGTTTAGTAAATTAATACTGAATGTAATTATAATTCTACAA
ATTTAGTTAGAATACAAATAACCAACACTCAAGGATTATTGATTTACAATATAACGGCAG
CACTCTAAATTTAGCCTAAACAGATTAACATTGTATCAATAAACACAATCTACTTAACAC
CGGATTCATAATCATAGTCACAACAGCTAAATTAATACTTTAATGTCTCAATGACTACTC
TTGAAATAAACTTTCAACTTTAATCCAGCTACTACCCATAATAATCAGCATTTATGATTT
ATATGCCTCCTCAGCTATCAAGAGATAGTAGAATAAGCAATGTTTCAGTTGATATATCTA
ATGAATTTCTTAATTATTGCAAAATTCAAACTAATTCTACATAAATTTCAAATTAAACTG
TAAATTACTAAAACAAAATTTAATAGAGAGAAGTAATTTCTATTATTTGCTAATAAAGTG
GAAACACAAATACTTAAAGTGTTTTTACTGTAACAATCTAAGGCTATCAATTACCAAGAT
AATTATAAAAACCAACAGATAGACTTATTATTGATTTAATTGACTTTTCTTAAAAGCAAA
ATCAGCCTTTGCCTCTATGCCTTACAACAGAAAATCCTGATATCTCAAATTAAGTTAAAA
GTAGTTGGGTTTTTACAAATACTAAATAAACTAGCTTTTTTGTTTCACAATATGATTTTA
AATTTAACGGTAGCTCTGACTAAAATACATTAACCCTTCAGTCTTTGTTAAATATGACAA
CGTATTACAATATTAGTGATGGAGACTTATTGTTCATATCCTTTTCAAAAATGAACTTTT
TTAAAATAGAAACTTTAAATGGAAAATTACTTCCAAATTAAAATTCTACTGAAAATAAAG
ATTTAAATTGTTCTTTGGTTTATCCTTAATCAAGCGCATAATCTTCTGCTTTATCTTAGT
GCATTTTATTAGAAACCCCTTCAAACTACTCAATTTAAATTACTCTTAAAACAGCTAATT
TGAATTCAATAAGTGGTTGGAATAGCAAAGATATCTTTATAACAATAAATTCATTAGCGT
TTTAGTAACTCCTTCCATCTAATAATACTAAAATTTAGTTTACGCACTTCTCAAGTGATC
AATATTTGTTAAGCTAATCTAATTATTTATTAAATAGCCAGTAAACAACTTCAAATGTAT
TTTACTCAATAAATTAAATAAGTTCTGTCACTCAGTAAACAATAACTAGCTTTGTCTAAA
CAATTAAATTTGATTTTATTAAAATTTAATTTTTAATGTAAACCTTAATGTCTACTTTAG
ATTCTGGATTAAATTTAGCTATAAACTTTTCATAACAAGTCTATTTTAATGTTCAAACAT
TTTGTTCTTTGGATAATATTTGCTCTTAGAGTAGTCATCAAATAAAATGCAGTGTCTCTT
CTGACGGATTTACTATCCTACTTAGTTAAATTGATTAAAATGCCTTTTGTTCTCCACCTG
TTTTGACTAACTTTGTAATTTGCAAATATTATTTAAATTTTGTTTATTAAGTTTAATCAG
ATAAAAACCCCTATTAATTTTAAAATTTTTAATCAAATATTAATATACAAAAATTTGTTA
AAAATTACTGGGATTAAAATTATATTTTATTTATTTATTAACTATTTATCAATTAAATAT
TATTAAATATATTAATTTATTTTAAAATAATAATTTTATTTCAAAAAGAATATCACAATT
CATAATCCTGAAATAAATAACTAAAATTCAACAGGAGGTGCTGCTTAATCAATAGCAATT
AATTGGAATTTAACAAGCACTACAAGCTCTTAAACTCTTTTGTCGGGACACACTTCATTA
ACTACCAACACCTCCTAATGTCCTTAACCTCACTGCGCCACTTGCACATCTCCTCCATCC
ATTTGCATTCACTGCACCCAAGGCTATTATTTACTTCCAGATCAAAACTCATGCGTCCAG
ACTTGTCCACCTCCAACAGTCGCTCATCAACAAACAGCTACTTGCCAGCCATGCTTCCAG
CACCAAGAGTGTCTTCAATGCCAGTCTCAAAACCCAGCTGCTTGCACCTCATGTTCTCCC
ACCTATTCCCTCAATTCCACTCTCCTCCCCTATTGCTACGTGCCTCTTCCTCCTTCTAGT
AGCGCTTCTTCCTCCGTCACCAAGGATGTTGTCAATCGCACGCCTTCTAACTCAACCTTT
TCAGGAGCACTCAATCGACCTGAGCCAGGACAGCCCTCACAAAAGTAGCAGTAGCAGTAG
TAGTAGTAGTAGCAGCAGGAGCAGCAGCAACAACAAGAACAACAACAGCAGGAGGCCCAA
GCTAGCGATCAGCGAGGCTTTGCTCATTTCTTAGCTCAAACCAAGTCTTATACGAAAGGC
TTTATTTTGACACTGCTGATTCCCCTCTCAATACTCGGTGCTTGCCTCACTAGGCTAGTC
ACCTTTTGTCTGAAAAAGCGAGAAAAGAAGGTGCATCCACCACTGCCTAGTGAATCGAGG
AGTGCACAGATTGCACAAAACTTGGATGAAAGGTAAGAAACACAAAAAGATGGAAATGGT
GGCGATGAAGAACAGATGAGAGCGTCTTCGAGGGTAGACACAGCAAATATGTGTCCTCTG
AACTCAAGAAGAGGCGAGTAGTTATAATTGGAAGGTGTGCAGTAATAAAGCGATGGTGGT
GTTGGTGGTGGGGAAAGTGAAGGAAACGGGTATTTAGCGTTCTGCTGGATAGCAGTGATC
CTTTTGTTGGGAAATGTGGGTGATTTAGTAGAGGTGCCTTATATTATCTTCTCACAGTAG
AACTCGTTTTCTAACAAAAGCACAACAAATGTATTTGACTTGTAATTTTCAGAAGCAGAC
ATGGGCTAGATTTGTTGTTTGAGCTACATCGCACTAAACGCAGTTTGCTACTTGATCTGC
GTCGTAATGATGGTAAAGGCTATAATTTTTGAGACTGGAAGTGGTGAGCCTCTGTTTTGT
ATTTACGAAGTGAAGCTGAGTAGCAGTAGCAGTTTTTGTGGAGAAGAAATGAAGAAGGAT
AAAAGTGAAGCTGCTGCGTGCAAAGGGGATTCGAATGCTTAGAATGAGAATGGAGAGAAG
CACAAAAAAGTGTTGAGTGGGCGAAAGCTATGGAAGCTAATAATAGATGTTTTCTTGAGA
TGTCTGGTAGTTGTTGGTGGAAAAGCTTTCTGCATGGTTTATTCAAACGTGGCAAATGTA
AAGGGATGGTTAACATGCTAAGTAGATAAAAATTTGAGAGCATTTAGATTGTTCTATATG
ACTTTGTGCATCCATGCAATCTTCAATATGATATCAGCAGTATTCTTTACTCTCATGCTT
ACTCATTTCTCCTTTGCTTCTTGGACTGCAGTAGCACAAGATAGCCTTACAAGCTAAGGT
AGCGATGGTGGAGTCGAATTTTCGTTCTTTGTTGACATCCTTGCATTTAAATTTTTAATG
TCTCTGATTTGTTTTTTGAACTGCCTGCATATCTAACAGCTAATTAGTGCCTGCAAATCT
CCTAATCTTCCTGGACCCTAAAATCCCGTTTCCCATCGACTCTAAAGCCCATCTACTCCT
TCTTCTTCCGCATCACCTGCAGACGCAGTAGAAAGAGACGCTTGCAAAGTTTCATACTTT
GAAAATACACCAAATGCTGCTGAAAAGACTACTCCAACTGCGGTAACGCTTGCCTCTTAT
CGCCAGCAAGAAACATCAGGAACTGGTTCTTAAAACCTCATAGAAGGTAGACCAAGGAGA
AAAAAACCATCAAAGTTGAGTCTATTGCTAAAAAGAGATTCAGGATAAAAATCTGGTAGT
TCACTTTCATCTAGACAGCAAGAAACACCTTCGCCAAATTTGCCTTCCTACTCTCCTAAT
CTCTACCCATCTCAAGCATACATTTGA