Identifiers and Description

Gene Model Identifier

TTHERM_01087810

Standard Name

MTA6 (Mating type gene )

Aliases

PreTt05182 | 227.m00038

Description

Required for matting type recognition.

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF07649 ) C1-like domain
  • ( PF01500 ) Keratin, high sulfur B2 protein
  • ( PF05316 ) Mitochondrial ribosomal protein (VAR1)
  • ( PF06247 ) Plasmodium ookinete surface protein Pvs28

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_01087810

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20056.12.9988601762256104e-132hypothetical protein (1520 aa)
OxytrichaContig1040.1.g1220.00000030014504373857585Protein of unknown function (D
UF3659)

General Information

Paragraph NoGene NameParagraph Text
93MTA6The germline MAT locus was discovered in 1953 and remains the only known Mating type locus in T. thermophila. The mat-1-like allele codes for mating type I,II,III,V,VI. The MTA and MTB genes determine mating type.These genes code for trans-membrane proteins that may localize to the cell surface. The proteins may play a role in self/non-self recognition, since cell-cell contact is required to stimulate cells for mating. The MTA6 and MTB6 genes have been shown to be necessary for mating type recognition, but may also play a role in cell-cell recognition during mating.

Associated Literature

  1. Ref:23555191: Cervantes MD, Hamilton EP, Xiong J, Lawson MJ, Yuan D, Hadjithomas M, Miao W, Orias E (2013) Selecting one of several mating types through gene segment joining and deletion in Tetrahymena thermophila. PLoS biology 11(3):e1001518

Sequences

>TTHERM_01087810(coding)
ATGCTATTCCTATTGGTGATCTTAAATATTTCAATACAGTAGACTCTCTGCGATTGGAGA
TTTGTTTAAATTTTAGATGGATTAATTTTGTAAATTAAAAATGATTTAAGCTTAGCTCAT
GTTTAGATTGTTACAAATGATGAATCTGCGATAACCAACTCAACTGTAAATCAAGATTAG
TTCTAAAATGTCCAGATTGTAAATTAGCTTTGGTTTTGGGCAAAGAACTAATAAAATTAT
CTGCTACCTTTTTCTTCAAACACCTTTAAAAGGAGAATGACCTATAACGTATATGATAAA
GATAATAATTTAGTAAATTATGGATCATTCAGAAGCTTCATTAAAATATTAAATGTTCAG
CAAAGATTAATTGATGGGAGCTTCAGAAGCAAGTAGCTCTCAATTGTTGCAAACACTTAT
AAATAATTTAAAATTGTCAATGACTCAAATGAAGATTACTATTTCCAAATCCAAGTATAA
ATAGGTAATAATCTTATTTAACAGCCTTAAAATATGTTTAACTTGTTAGTAGATGGCCAG
CAAATAAACAGTTTTTAAAGTTGCTAAAGTAATATGCTATTTTCTATTTGTTAGTGCTTC
AAGCAAACAGATTTCCCATAATAATTCAAAAATTTAGAGTTTGTCTTTTAATAGTATTTA
ATTTCAAGTATTTAGATCAAAATGCAGTTATACAATCAAGTGAGCTCATTCGAATCTATA
GATATTAGCACTTTCAATTAGTTTTACTCTGTTTAATATCTTCTCAGTAATGACATGTAA
GCATTAGTAAGACCTTCTTCGTTAGGTAAACTGTTAGCTTATGAACTTGCATTTAATCTG
AATTTTACAATATTTGTAAATTGTGATTTATATTAAATCATTTTACCACCAAGTATAAGC
TAACAATTTACAAAGGCAGCACCAACTTTAATGGCATAATTCTAAACCAATAGTAATTTT
ACTGAATAAGTTACTGATTACTACAATAATGGAACTTTAATTTTACAAAAAAGTCTTTCT
TTTAAATCTAGCAATACTCTTAATAATATCTAGATTTTGATATAATAATTTGAATTTTAA
GATTAAATAGACGATAATTCTTCCTCAAGTATTGTTTTTAATTGCAGTTAAAACAACTTA
TTTGTTAAGAACTTTACTATTTCTAAGATATAATTACCAAATGCTAATCTAACTCAGACA
TAAATTGTATTGAATAATACAGATATTCCAACTTTGAATATTATAATTCAAATACCTCCA
ATAAATATCCTAAGTTCAGTTTTAACTTTAGAACTTCCTAATGGAGTTTAATGCTTAAAT
TAATCTTAGACTAATATTCTAACAAACGGATTTGTTTATTCTCAGTATTAATCGATTGAT
AATTCAATAAGCTTCCTGTCAACAAACTTCACATCTGCCTCTATTTCAATCACTTTTACA
AAAGTAAATAAAATTGATGGAAATCAAAATCTAACAAAAATAAATGTAAAATGCATCTTT
AATTCCACAGTTTTATTTTATGTTGACGCAAATACTTAATAGACAATAACTATAATTTAA
CCTCCTTCTCCTCCTCCGCAAACTCAAATATAAATAAACAGCTTCAACTAAACAAGTTTC
TCGTCTTTGAGTATTTATGAAAATAGAACTTCTGTGCTCTCATAATTAGCTTTTTCTTTC
TCTATTTTAAAATTTCTAGAGACATGTTCTTGGCTTATTGTCTCTTTACCATTAGAATTC
ACAACAAGCTTTTAGCAAAATTCTTCATTTAATCTTTTTGGCTGCCATGGAAATAATTAT
TAATACACTCAAGTAAATCCACTTTCTGCCTAGTCTGTTATTGGCTATACATAAAATAAC
AATTGCATCTACATTTCTTGTTTAGCTTTATAACAATTCTCACAGCTAAACAACAACAAT
AATAATAACTATTGCTTGAATAATACAGTTACTATTTAAAATGTAAAAAGTTATGATTTA
GCCACTTAGACTTAAGGATTAAAAATTTTTGTTGCAAACAGAAATAGTTCAAATAAATAG
GATCTGAATCCACCTACTTTTTTTAGTGAGAATTTAGATTTAAATAATAATAGCTTACCT
TATTATTTCACGAACTCAGAAGTATCTACTTATCAAGGTATAAATTTAACAGAAGTTGAT
TTGAGTTATTTAGCATTCAATACAATATCAACATACTTAAGAGATATCTTCAATTTTACT
ATGACCTTTTCTTACCCAATATATTTATGGGAGAAGCATCATCTAAACATTTAATTACCA
TACTAATTTCTTGGTAGTAATAATATCACTTGCTAACCTGCTTCTTTTGTTTAATGTTCT
CTATAAATGGGAACTCAACAAAACTATTCAACTTTAAATTTACTCATCCTCTAATAAGTC
CTTCCAGATACAAAAATAACTATCGAAGTTTATTAAGTAGTAGTAGTAGCTGAGAATACT
ATTTAGTAGAAATAAGCAGTAATAAAGTTATTTTTAGAAAACAGACTTATAAACACTAAA
AGTAAGATCATAGATGTTTTGAGTGATTTAATGCCTTAAAATTTTATTGTATTTTCAACT
AGTTCTCCTCTTTAATTATCAAATTCTCTACTTGGATTAAGTGATGTGAATTACACTTTT
TTTATTAAATAAATGAATTTGCCTCCCAAAATAAATGATAATTATTACCTTTCCCTAACC
TTAGATTAAAGTTTTCTTCTAGTATCTAATAATTACAATTGCTCAATTCTGACTTAAGGA
GAAAATTAAATCTATTTAGAATAATAATTAAAGTGTCTTTTTTATTTTCCTAACAACTTT
ATTTTTTCTATTTCTAGCTTCGCAATAATGTCTCAGCCATTTTAACTTAGAATAAGTGGT
TTGAGAAATCCCTCTGGTATTGTTGAATAAAATGAATAAAATGTAGCCTAGACATATAAT
TTTTAATTGATATGGAGTACACAATAAGGAAATAGTTTCAAAAATGTTTGGCTTATATAA
TCAGTTAGTCTCCCAATCACTTCCAAATATACTTGCTCACCCAATTGCTAAGCTTGCGCA
TCAAATTACGCTGCTTGTACAGCTTGTGCTCCTGGATATCTCAAGTCGCAGTACAATCAT
CACGCCGTCCTTGCTTGTCTTCCTACATGCAGCCCTTAATATGTAGCCTATAATGGTACT
TGTTTAGCTTGCTAGCTAAAAGACCCTTAATGCTTGTCATGTTCGCCTTCAAATCTCACT
TAATGCTCAAGCTGCAATCAAGGATATACGCTGGTGCCTGAGTTCAACGGGTGCGTCGAT
AGTCACTTGCTTCAGACAGCAAGATCAAGATTATTAGATTACTCTTTATCTACAAATCTT
GCAGATAATATAGACACTACTCATCCAGATGATGCACAAAAATCAGACAAAGCGCAATCC
TTGACTAGAATGACTGAAGAAAGTTCAAGTGCTAAGGCCGATTAAAGGGAAGGCGGCGAA
AGCAGCAGCAATACTGGCAGTAAGGTTATGGGCCAGTTGCAAGATACTGTAGGCGCTTTA
AAAGGAGGAGGAGCAATCTTTATATGGATAGTGTTGGCAGCATTGGCAGTGAGTGTGAGT
TAGAGCGTTCTCAGATACACCTACAATAAATTGAAAGGGAAGAGTCATTCGAATGGGAGC
AGCAGCGGCATGAGGAGGAGCAGCAGCGGCAGTAGAAGCAGCAGCAGTGGTAGCAGTAGC
GCTGGAAGGAATGCGAGTGGGAAAGAGCATAAAGGAGTGAGAGAAAGAGAAAAGGAATTG
CGTGGTTAGCGAATAGATTGTCTTATGCTTTTTTTGTTAAGTGTTGCTGAGGCTATTCAA
ATGCCTTACACTCTTTTGTGGGGTTTTTCAGTATCAGGAGGGGATTTTGAGAGTCCTGTT
TTGTAAACCTTGCTCGGAGCTTGTGCATTGAGCACTCTATTGTGGATTTTTGATGCATAT
TTGTTAGGTTCTATCCTTGCAAACTCGGAGAACACGCCAAAGACTAGCTGTCTTTTGAAT
CCTCTGCCCTCTTCAAAGAGGGAAGGCTGTCTTTCTTTTCTAATAGTACCTGCAAGATTA
GCTTTCTGCCTCATACCTAAGTCTGTGAGCTTGACACTAACTAATATCTTTTCAGTTGAA
GGGTGGTTTAGATATCCATATGGAGAAGACGTCGAAAGAGCTACCATTGTGCTGACAAAC
TTTAGAAAAGTGCTTTCGTCTTAAATCAAGAGCAACGTTTCAGGTTTATGCTCACTTGTG
TCCTTTCTGATCCTGCAGTATCCTGAAGTACTCTCCAGCTACGTGCAAATTTACGATCTT
ATTATTTTTGATATTGTAATGACAATCCTCTGTCTCACTAACATCAGAAATGTAGACAAG
CTAATCTCCACCTTAAATCAAATCTAAGAAAGCGAGGGAGAGCTTTGA


>TTHERM_01087810(protein)
MLFLLVILNISIQQTLCDWRFVQILDGLILQIKNDLSLAHVQIVTNDESAITNSTVNQDQ
FQNVQIVNQLWFWAKNQQNYLLPFSSNTFKRRMTYNVYDKDNNLVNYGSFRSFIKILNVQ
QRLIDGSFRSKQLSIVANTYKQFKIVNDSNEDYYFQIQVQIGNNLIQQPQNMFNLLVDGQ
QINSFQSCQSNMLFSICQCFKQTDFPQQFKNLEFVFQQYLISSIQIKMQLYNQVSSFESI
DISTFNQFYSVQYLLSNDMQALVRPSSLGKLLAYELAFNLNFTIFVNCDLYQIILPPSIS
QQFTKAAPTLMAQFQTNSNFTEQVTDYYNNGTLILQKSLSFKSSNTLNNIQILIQQFEFQ
DQIDDNSSSSIVFNCSQNNLFVKNFTISKIQLPNANLTQTQIVLNNTDIPTLNIIIQIPP
INILSSVLTLELPNGVQCLNQSQTNILTNGFVYSQYQSIDNSISFLSTNFTSASISITFT
KVNKIDGNQNLTKINVKCIFNSTVLFYVDANTQQTITIIQPPSPPPQTQIQINSFNQTSF
SSLSIYENRTSVLSQLAFSFSILKFLETCSWLIVSLPLEFTTSFQQNSSFNLFGCHGNNY
QYTQVNPLSAQSVIGYTQNNNCIYISCLALQQFSQLNNNNNNNYCLNNTVTIQNVKSYDL
ATQTQGLKIFVANRNSSNKQDLNPPTFFSENLDLNNNSLPYYFTNSEVSTYQGINLTEVD
LSYLAFNTISTYLRDIFNFTMTFSYPIYLWEKHHLNIQLPYQFLGSNNITCQPASFVQCS
LQMGTQQNYSTLNLLILQQVLPDTKITIEVYQVVVVAENTIQQKQAVIKLFLENRLINTK
SKIIDVLSDLMPQNFIVFSTSSPLQLSNSLLGLSDVNYTFFIKQMNLPPKINDNYYLSLT
LDQSFLLVSNNYNCSILTQGENQIYLEQQLKCLFYFPNNFIFSISSFAIMSQPFQLRISG
LRNPSGIVEQNEQNVAQTYNFQLIWSTQQGNSFKNVWLIQSVSLPITSKYTCSPNCQACA
SNYAACTACAPGYLKSQYNHHAVLACLPTCSPQYVAYNGTCLACQLKDPQCLSCSPSNLT
QCSSCNQGYTLVPEFNGCVDSHLLQTARSRLLDYSLSTNLADNIDTTHPDDAQKSDKAQS
LTRMTEESSSAKADQREGGESSSNTGSKVMGQLQDTVGALKGGGAIFIWIVLAALAVSVS
QSVLRYTYNKLKGKSHSNGSSSGMRRSSSGSRSSSSGSSSAGRNASGKEHKGVREREKEL
RGQRIDCLMLFLLSVAEAIQMPYTLLWGFSVSGGDFESPVLQTLLGACALSTLLWIFDAY
LLGSILANSENTPKTSCLLNPLPSSKREGCLSFLIVPARLAFCLIPKSVSLTLTNIFSVE
GWFRYPYGEDVERATIVLTNFRKVLSSQIKSNVSGLCSLVSFLILQYPEVLSSYVQIYDL
IIFDIVMTILCLTNIRNVDKLISTLNQIQESEGEL


>TTHERM_01087810(gene)
ATGCTATTCCTATTGGTGATCTTAAATGTAGGCAATTTAATTCTACTATTTATCATTTTA
GCTCCCTTTAATAAAATATTATTCATATAATTTTTAATGAAAATTGAATTCCTTCATGAA
TACAATTTAGTTCTACTATGTTATAAAACCCACTTATTTTTTAAATAAAGTATTATTTAA
TGGTGTTGAAATAATTTTTTTGTTATTTTTATATAGATTTCAATACAGTAGACTCTCTGC
GATTGGAGATTTGTTTAAATTTTAGATGGATTAATTTTGTAAATTAAAAATGATTTAAGC
TTAGCTCATGTTTAGATTGTTACAAATGATGAATCTGCGATAACCAACTCAACTGTAAAT
CAAGATTAGTTCTAAAATGTCCAGATTGTAAATTAGCTTTGGTTTTGGGCAAAGAACTAA
TAAAATTATCTGCTACCTTTTTCTTCAAACACCTTTAAAAGGAGAATGACCTATAACGTA
TATGATAAAGATAATAATTTAGTAAATTATGGATCATTCAGAAGCTTCATTAAAATATTA
AATGGTTTGTTTATATTTTTTGAGATTTTCATTTTAAAAACTCATTATTAATTTTAAAGT
TCAGCAAAGATTAATTGATGGGAGCTTCAGAAGCAAGTAGCTCTCAATTGTTGCAAACAC
TTATAAATAATTTAAAATTGTCAATGACTCAAATGAAGATTACTATTTCCAAATCCAAGT
ATAAATAGGTAATAATCTTATTTAACAGCCTTAAAATATGTTTAACTTGTTAGTAGATGG
CCAGGTAGTTATCTATTTATTTATTTGATTTCTTCTAAAAATTTAATTATTTTATCTTAT
TAGCAAATAAACAGTTTTTAAAGTTGCTAAAGTAATATGCTATTTTCTATTTGTTAGTGC
TTCAAGCAAACAGATTTCCCATAATAATTCAAAAATTTAGAGTTTGTCTTTTAATAGTAT
TTAATTTCAAGTATTTAGATCAAAATGCAGTTATACAATCAAGTGAGCTCATTCGAATCT
ATAGATATTAGCACTTTCAATTAGTTTTACTCTGTTTAATATCTTCTCAGTAATGACATG
TAAGCATTAGTAAGACCTTCTTCGTTAGGTAAACTGTTAGCTTATGAACTTGCATTTAAT
CTGAATTTTACAATATTTGTAAATTGTGATTTATATTAAATCATTTTACCACCAAGTATA
AGCTAACAATTTACAAAGGCAGCACCAACTTTAATGGCATAATTCTAAACCAATAGTAAT
TTTACTGAATAAGTTACTGATTACTACAATAATGGAACTTTAATTTTACAAAAAAGTCTT
TCTTTTAAATCTAGCAATACTCTTAATAATATCTAGATTTTGATATAATAATTTGAATTT
TAAGATTAAATAGACGATAATTCTTCCTCAAGTATTGTTTTTAATTGCAGTTAAAACAAC
TTATTTGTTAAGAACTTTACTATTTCTAAGATATAATTACCAAATGCTAATCTAACTCAG
ACATAAATTGTATTGAATAATACAGATATTCCAACTTTGAATATTATAATTCAAATACCT
CCAATAAATATCCTAAGTATTTTATTATTTCTTAAGCAATTTATTAAAAAATTAATAAAA
TTTAGGTTCAGTTTTAACTTTAGAACTTCCTAATGGAGTTTAATGCTTAAATTAATCTTA
GACTAATATTCTAACAAACGGATTTGTTTATTCTCAGTATTAATCGATTGATAATTCAAT
AAGCTTCCTGTCAACAAACTTCACATCTGCCTCTATTTCAATCACTTTTACAAAAGTATT
AATAAATCATTTCATTATTTTTTAACATATTTAATATTTTTCAAAGGTAAATAAAATTGA
TGGAAATCAAAATCTAACAAAAATAAATGTAAAATGCATCTTTAATTCCACAGTTTTATT
TTATGTTGACGCAAATACTTAATAGACAATAACTATAATTTAACCTCCTTCTCCTCCTCC
GCAAACTCAAATATAAATAAACAGCTTCAACTAAACAAGTTTCTCGTCTTTGAGTATTTA
TGAAAATAGAACTTCTGTGCTCTCATAATTAGCTTTTTCTTTCTCTATTTTAAAATTTCT
AGAGACATGTTCTTGGCTTATTGTCTCTTTACCATTAGAATTCACAACAAGCTTTTAGCA
AAATTCTTCATTTAATCTTTTTGGCTGCCATGGAAATAATTATTAATACACTCAAGTAAA
TCCACTTTCTGCCTAGTCTGTTATTGGCTATACATAAAATAACAATTGCATCTACATTTC
TTGTTTAGCTTTATAACAATTCTCACAGCTAAACAACAACAATAATAATAACTATTGCTT
GAATAATACAGTTACTATTTAAAATGTAAAAAGTTATGATTTAGCCACTTAGACTTAAGG
ATTAAAAATTTTTGTTGCAAACAGAAATAGTTCAAATAAATAGGATCTGAATCCACCTAC
TTTTTTTAGTGAGAATTTAGATTTAAATAATAATAGCTTACCTTATTATTTCACGAACTC
AGAAGTATCTACTTATCAAGGTATAAATTTAACAGAAGTTGATTTGAGTTATTTAGCATT
CAATACAATATCAACATACTTAAGAGATATCTTCAATTTTACTATGACCTTTTCTTACCC
AATATATTTATGGGAGAAGCATCATCTAAACATTTAATTACCATACTAATTTCTTGGTAG
TAATAATATCACTTGCTAACCTGCTTCTTTTGTTTAATGTTCTCTATAAATGGGAACTCA
ACAAAACTATTCAACTTTAAATTTACTCATCCTCTAATAAGTCCTTCCAGGTAAATATAA
TTTTCTTTAATTTTAATATAATAAATATTATAACACAAAGATACAAAAATAACTATCGAA
GTTTATTAAGTAGTAGTAGTAGCTGAGAATACTATTTAGTAGAAATAAGCAGTAATAAAG
TTATTTTTAGAAAACAGACTTATAAACACTAAAAGTAAGATCATAGATGTTTTGAGTGAT
TTAATGCCTTAAAATTTTATTGTATTTTCAACTAGTTCTCCTCTTTAATTATCAAATTCT
CTACTTGGATTAAGTGATGTGAATTACACTTTTTTTATTAAATAAATGAATTTGCCTCCC
AAAATAAATGATAATTATTACCTTTCCCTAACCTTAGATTAAAGTTTTCTTCTAGTATCT
AATAATTACAATTGCTCAATTCTGACTTAAGGAGAAAATTAAATCTATTTAGAATAATAA
TTAAAGTGTCTTTTTTATTTTCCTAACAACTTTATTTTTTCTATTTCTAGCTTCGCAATA
ATGTCTCAGCCATTTGTAAATTATTATTTTTTACTTAAAAAATTATTTGCTGCCAACAAA
AATATCGATATATTTCACAAAGCTCTACAAATATTTTTTTTATAATATAAATATAGTTAG
TTAGTTAAAAAGTATTTTTTTAAAACCCCCATCTTGCTAAATAATAGCTTATTATAAAAT
TATTCTAATAAATTTTTTTAATTTTTTTAGTAGGGTTTTTAGTTAATATTATTTTTATAA
TTTTAAATAATTTTTATTTATTATTATTTGATAATCAAAAATTAGTAACTTAGAATAAGT
GGTTTGAGAAATCCCTCTGGTATTGTTGAATAAAATGAATAAAATGTAGCCTAGACATAT
AATTTTTAATTGATATGGAGTACACAATAAGGAAATAGTTTCAAAAATGTTTGGCTTATA
TAATCAGTTAGTCTCCCAATCACTTCCAAATATACTTGCTCACCCAATTGCTAAGCTTGC
GCATCAAATTACGCTGCTTGTACAGCTTGTGCTCCTGGATATCTCAAGTCGCAGTACAAT
CATCACGCCGTCCTTGCTTGTCTTCCTACATGCAGCCCTTAATATGTAGCCTATAATGGT
ACTTGTTTAGCTTGCTAGCTAAAAGACCCTTAATGCTTGTCATGTTCGCCTTCAAATCTC
ACTTAATGCTCAAGCTGCAATCAAGGATATACGCTGGTGCCTGAGTTCAACGGGTGCGTC
GATAGTCACTTGCTTCAGACAGCAAGATCAAGATTATTAGATTACTCTTTATCTACAAAT
CTTGCAGATAATATAGACACTACTCATCCAGATGATGCACAAAAATCAGACAAAGCGCAA
TCCTTGACTAGAATGACTGAAGAAAGTTCAAGTGCTAAGGCCGATTAAAGGGAAGGCGGC
GAAAGCAGCAGCAATACTGGCAGTAAGGTTATGGGCCAGTTGCAAGATACTGTAGGCGCT
TTAAAAGGAGGAGGAGCAATCTTTATATGGATAGTGTTGGCAGCATTGGCAGTGAGTGTG
AGTTAGAGCGTTCTCAGATACACCTACAATAAATTGAAAGGGAAGAGTCATTCGAATGGG
AGCAGCAGCGGCATGAGGAGGAGCAGCAGCGGCAGTAGAAGCAGCAGCAGTGGTAGCAGT
AGCGCTGGAAGGAATGCGAGTGGGAAAGAGCATAAAGGAGTGAGAGAAAGAGAAAAGGAA
TTGCGTGGTTAGCGAATAGATTGTCTTATGCTTTTTTTGTTAAGTGTTGCTGAGGCTATT
CAAATGCCTTACACTCTTTTGTGGGGTTTTTCAGTATCAGGAGGGGATTTTGAGAGTCCT
GTTTTGTAAACCTTGCTCGGAGCTTGTGCATTGAGCACTCTATTGTGGATTTTTGATGCA
TATTTGTTAGGTTCTATCCTTGCAAACTCGGAGAACACGCCAAAGACTAGCTGTCTTTTG
AATCCTCTGCCCTCTTCAAAGAGGGAAGGCTGTCTTTCTTTTCTAATAGTACCTGCAAGA
TTAGCTTTCTGCCTCATACCTAAGTCTGTGAGCTTGACACTAACTAATATCTTTTCAGTT
GAAGGGTGGTTTAGATATCCATATGGAGAAGACGTCGAAAGAGCTACCATTGTGCTGACA
AACTTTAGAAAAGTGCTTTCGTCTTAAATCAAGAGCAACGTTTCAGGTTTATGCTCACTT
GTGTCCTTTCTGATCCTGCAGTATCCTGAAGTACTCTCCAGCTACGTGCAAATTTACGAT
CTTATTATTTTTGATATTGTAATGACAATCCTCTGTCTCACTAACATCAGAAATGTAGAC
AAGCTAATCTCCACCTTAAATCAAATCTAAGAAAGCGAGGGAGAGCTTTGA