Identifiers and Description

Gene Model Identifier

TTHERM_00763040

Standard Name

MSH5 (Homolog of budding yeast MSH5)

Aliases

PreTt03295 | 126.m00093 | 3740.m00020

Description

Meiotic pro-crossover factor along with MSH4, MutS domain V family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00488 ) MutS domain V
  • ( PF08181 ) DegQ (SacQ) family
  • ( TIGR00634 ) DNA repair protein RecN
  • ( PF02463 ) RecF/RecN/SMC N terminal domain
  • ( TIGR03058 ) chlorosome envelope protein H
  • ( TIGR00611 ) DNA replication and repair protein
  • ( TIGR00075 ) hydrogenase expression/formation protein HypD

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00763040

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_15991.11.0003391709219401e-98hypothetical protein (920 aa)
WormBaseWBGene000034211.0000422327488734e-24locus:msh-5 MutS protein hom
olog 5 status:Confirmed Un
iProt:Q19272 protein_id:CAA9
8059.2
DictyBaseDDB_G02847476.996829646809514e-23msh5 on chromosome: 4 position
2423376 to 2426473
OxytrichaContig18281.0.g805.0013199114200274e-20MutS domain V
SGDYDL154W2.999758165421992e-18MSH5 Protein of the MutS famil
y, forms a dimer with Msh4p th
at facilitates crossovers betw
een homologs during meiosis; m
sh5-Y823H mutation confers tol
erance to DNA alkylating agent
s; homologs present in C. eleg
ans and humans
Stentor CoeruleusSteCoe_155850.0000000000002543665647376923

General Information

Paragraph NoGene NameParagraph Text
98MSH5Msh5 (together with Msh4) is required for normal chiasma formation
99MSH5Transcript is annotated by gene_000007168

Associated Literature

  1. Ref:28100637: Shodhan A, Kataoka K, Mochizuki K, Novatchkova M, Loidl J (2017) A Zip3-like protein plays a role in crossover formation in the SC-less meiosis of the protist Tetrahymena. Molecular biology of the cell ( ):
  2. Ref:25217051: Shodhan A, Lukaszewicz A, Novatchkova M, Loidl J (2014) Msh4 and Msh5 function in SC-independent chiasma formation during the streamlined meiosis of Tetrahymena. Genetics 198(3):983-93

Sequences

>TTHERM_00763040(coding)
ATGTGTTAAATAAGTATATTTTAAGAATAGAATAGTTTAGGTGTTAGTTATTATGATCCT
AAATAAAACAGAATATTCTGTTACTAGATAAATATACTAAATGAGGAAGAACATATATAA
AACCTTTTTTTATAGTTTGATAATATATATGCTCTAATAATACCATTAAATTTTAATGAA
AACTTAGTTTAAAGTGTAATAGAAAAATATTTTTTAACACAAAACAGACATTTGAATATT
CAAAGAGTCTTAAATTGTGAATATAATTTTGAAAGTTGCATAAATAAAATCTTGTAATTA
AATTTTGATAAAGATTTAAATTAATCGCTTTAAAATAGCCAAGAAATGACAATCAGTAAA
AACTAACAATCAATATCATTACAATGTGATGAGAACTTCAAAAATCGAAACAATAAAAAA
TATCTAACTCTTTGCTAATAAATAGACATAGAGTAAAAAAACTTAATAAAATCATTAGGT
GGGTTATTATGCTTCCTGTTCAATAATTAGATTATTAATTTGAATTATTCGTTTTTTGAC
ATAGTATTTCTTAAAAACATAAATAATTAAATACATTACAATCAATACACTCTAAGTTAT
TTGAATATATTTAAAGAAGACATTCATCCATCAATGATTAAAGGTAAAGGTTAAGCTAAA
GAAGGTTTTTCTTTGTTTTTACTATTCTCAAAATTTGTATACACTAAATTAGGACTGATT
AAATTAAAGCACCTATTTTTAACTCCTTCATTTGATTTGAAAACTCTATAATTAAGAAAT
CAGTCAATAGATTTTTTTTATTCTTAATCTGGAGAAAGCATTAAGAAAATTAAACTCAAC
CTCTAAAAGTGTTCAAATATTAAAAAAGTTCTAAGTAAATTGAAATAAGTACAAATGAAT
TTTAATGATTGGTATAGCTTTAAAATTACGCTGCAAAGCACATTAAACATAATGTAATTA
TTTTTAATATAAAATGAAATACTTAAAAACCGAAAACTTTTAGTATTTCAGAATCTATCA
GATTATTTATTTTAAGAACTACAAAAATTGAATTCTTTTTTAGAAAAATATCTATTGTTC
TCACCAAAAGATGGTGAAATTATGATAAGAGAAGGTATAGTATAAGAATTAGATGATCTT
TTAAAAATATATGATAATTTAGATGAAATTTTAAGTTATTATAATAGTTAAGAAATAATT
AAACTGACTAATAATAATTCGAATTTCAACTCTTAGATGATGATTTAATATTTTCCATAA
CTAGGATTTTTCATAACTATACAAAACTCTAATTAATTCAATAATCAAGTATAGGTCGAT
GATAAGGTTAACTTCTCTTAAAATAAAAGCTATCAGGATCAGTAAAACAATTATTCATTA
GAATAAGATTGCTGTGAAAATTCAAAAGAACAAAAACAGAATGCTTTGAAAAGTGATAAA
AGTTTTTATCAGGATGGGAAATAATTAGATGACGATGAAGTTGAGGAAAAATAAAATTAA
AGCTAGTAAAATTTAAAAAGAACCAGGAGCAGTAATAGTCTTTCTTCTAAAAATTAAGGA
ATAGAAAATTCCTAGAATTTATAATAATAATACTGTTTAACTAATGACTACTCTTACTGT
TTCACACTATAAGATGCTCTTTTATTTAAAAACGATTTATGTAACTAACTAGATTTAAAA
TATGGAGATATTCAAAGCAGAATAATTGATATATAAAGAGATATAGTAAGAGAAATAGAA
CAATAAATTTTGTTATACAGTGAAGAAATAAATGCAGCTTAAGAATTTATAAGCGATCTA
GATCTTTTTTTTTGTTTGTATCAAGCTGCTGAAGTATATAATTTAAGAAAACCTAAACTT
ACAAATGATTCTTCATTAGTTTTTTAAGAAATGAGGAATATATTAACAGAAATAACAATA
GGTGAAAAATAATTTATTTCTAACAGTTTTTGTGTTCACAATTTTGCTCAATATATGAAG
AACTAAAAAATATAAACTAATAATTTTTTAGATTCCTAGTTTAGTAATAGATTTACATTT
ATAACAGGTCCTAATTATGCAGGCAAAAGTGTTTTCTTAAAAAGTATCGGAATGATTACC
TATCTTGCTCATATTGGTAGCTTTATTCCTTGCAGATTTGCCAGAATAGGAATGATAGAT
AATATTTTTGTAAATACTTGCTAACATGATTCAGTTCTAAAATTCAATGGAGAGTCAGCA
TAGCAACTTTAATTCATAAACTACATTTTAAACTAAGCTACTAATAGAACTTTAATACTC
ATAGATGAATTCGGAAAAAATTTCAGGCTTAACGATAGTTTAAATTTAAATTACTCCCTA
GTTAAGTGCTTGACAGAAGATACATTCTAAGGTTTAAATGAAAAAATAACTTAAAAATAA
CATCCTTCTTTGTAATAAGAAGATAATGATTAAAACATTTTTTATTAATATTAAACTGAT
AATTCTTAAGTGGAAAATATTGATGAAATAAAATAGTAAAATTTGAGAGGTTTGAATGAG
TTTCAGTTTATACATTAAGACATTTAAAATGTTAATTTAATGGAACAATACAATAAAATT
CCTATCACTCTGATGGCAAGCCACTTAAGTTAGCTTGTTAATTTGTGTGGACTGAGAGAA
AACTATATAATTAGATTTGCATAAATGGAAGTATTAATATAATAAGGAAAAAATGTTTGC
AAACTTAATGAATTAAAGGAGAATATTAATGCTATGCAGAAGATTGTTCATGTATATAAA
CTAAATAAAGGTTTATCCTTAAAAAGTTGCTCCTCATTAGTTGCTAAGAATATTTTCAGA
GATAATGAATATCTTATTCATAGAATTAATGAAATAAATTAATTTATTTTAGAAGGAAAA
TTTTAAGTCTCGCCATAATAAAATGTTGAATAAATTCATCTTGAAAAGGTTTAAAAAGTT
ATAAATATTTTAAATTCTTTGAAAGAGTAATAAATTTAATGA


>TTHERM_00763040(protein)
MCQISIFQEQNSLGVSYYDPKQNRIFCYQINILNEEEHIQNLFLQFDNIYALIIPLNFNE
NLVQSVIEKYFLTQNRHLNIQRVLNCEYNFESCINKILQLNFDKDLNQSLQNSQEMTISK
NQQSISLQCDENFKNRNNKKYLTLCQQIDIEQKNLIKSLGGLLCFLFNNQIINLNYSFFD
IVFLKNINNQIHYNQYTLSYLNIFKEDIHPSMIKGKGQAKEGFSLFLLFSKFVYTKLGLI
KLKHLFLTPSFDLKTLQLRNQSIDFFYSQSGESIKKIKLNLQKCSNIKKVLSKLKQVQMN
FNDWYSFKITLQSTLNIMQLFLIQNEILKNRKLLVFQNLSDYLFQELQKLNSFLEKYLLF
SPKDGEIMIREGIVQELDDLLKIYDNLDEILSYYNSQEIIKLTNNNSNFNSQMMIQYFPQ
LGFFITIQNSNQFNNQVQVDDKVNFSQNKSYQDQQNNYSLEQDCCENSKEQKQNALKSDK
SFYQDGKQLDDDEVEEKQNQSQQNLKRTRSSNSLSSKNQGIENSQNLQQQYCLTNDYSYC
FTLQDALLFKNDLCNQLDLKYGDIQSRIIDIQRDIVREIEQQILLYSEEINAAQEFISDL
DLFFCLYQAAEVYNLRKPKLTNDSSLVFQEMRNILTEITIGEKQFISNSFCVHNFAQYMK
NQKIQTNNFLDSQFSNRFTFITGPNYAGKSVFLKSIGMITYLAHIGSFIPCRFARIGMID
NIFVNTCQHDSVLKFNGESAQQLQFINYILNQATNRTLILIDEFGKNFRLNDSLNLNYSL
VKCLTEDTFQGLNEKITQKQHPSLQQEDNDQNIFYQYQTDNSQVENIDEIKQQNLRGLNE
FQFIHQDIQNVNLMEQYNKIPITLMASHLSQLVNLCGLRENYIIRFAQMEVLIQQGKNVC
KLNELKENINAMQKIVHVYKLNKGLSLKSCSSLVAKNIFRDNEYLIHRINEINQFILEGK
FQVSPQQNVEQIHLEKVQKVINILNSLKEQQIQ


>TTHERM_00763040(gene)
GAAAAATATCAAACTTTTTGTACAATATGTGTTAAATAAGTATATTTTAAGAATAGAATA
GTTTAGGTGTTAGTTATTATGATCCTAAATAAAACAGAATATTCTGTTACTAGATAAATA
TACTAAATGAGGAAGAACATATATAAAACCTTTTTTTATAGTTTGATAATATATATGCTC
TAATAATACCATTAAATTTTAATGAAAACTTAGTTTAAAGTGTAATAGAAAAATATTTTT
TAACACAAAACAGACATTTGAATATTCAAAGAGTCTTAAATTGTGAATATAATTTTGAAA
GTTGCATAAATAAAATCTTGTAATTAAATTTTGATAAAGATTTAAATTAATCGCTTTAAA
ATAGCCAAGAAATGACAATCAGTAAAAACTAACAATCAATATCATTACAATGTGATGAGA
ACTTCAAAAATCGAAACAATAAAAAATATCTAACTCTTTGCTAATAAATAGACATAGAGT
AAAAAAACTTAATAAAATCATTAGGTGGGTTATTATGCTTCCTGTTCAATAATTAGATTA
TTAATTTGAATTATTCGTTTTTTGACATAGTATTTCTTAAAAACATAAATAATTAAATAC
ATTACAATCAATACACTCTAAGTTATTTGAATATATTTAAAGAAGACATTCATCCATCAA
TGATTAAAGGTAAAGGTTAAGCTAAAGAAGGTTTTTCTTTGTTTTTACTATTCTCAAAAT
TTGTATACACTAAATTAGGACTGATTAAATTAAAGCACCTATTTTTAACTCCTTCATTTG
ATTTGAAAACTCTATAAGTAATTTTTATTTTTACATTTTAAATATCATAATACTATTTCG
GAATTAGACTTAAATTTATGATAATTTATTACTTATATTTTAATTAAAATCAAGTTAAGA
AATCAGTCAATAGATTTTTTTTATTCTTAATCTGGAGAAAGCATTAAGAAAATTAAACTC
AACCTCTAAAAGTGTTCAAATATTAAAAAAGTTCTAAGTAAATTGAAATAAGTACAAATG
AATTTTAATGATTGGTATAGCTTTAAAATTACGCTGCAAAGCACATTAAACATAATGTAA
TTATTTTTAATATAAAATGAAATACTTAAAAACCGAAAACTTTTAGTATTTCAGAATCTA
TCAGATTATTTATTTTAAGAACTACAAAAATTGAATTCTTTTTTAGAAAAATATCTATTG
TTCTCACCAAAAGATGGTGAAATTATGATAAGAGAAGGTATAGTATAAGAATTAGATGAT
CTTTTAAAAATATATGATAATTTAGATGAAATTTTAAGTTATTATAATAGTTAAGAAATA
ATTAAACTGACTAATAATAATTCGAATTTCAACTCTTAGATGATGATTTAATATTTTCCA
TAACTAGGATTTTTCATAACTATACAAAACTCTAATTAATTCAATAATCAAGTATAGGTC
GATGATAAGGTTAACTTCTCTTAAAATAAAAGCTATCAGGATCAGGTATAGATATTTTTT
TAAAAGTTTATTATATTAAAATTTATAAAATTAAAAAAAGTAAAACAATTATTCATTAGA
ATAAGATTGCTGTGAAAATTCAAAAGAACAAAAACAGAATGCTTTGAAAAGTGATAAAAG
TTTTTATCAGGATGGGAAATAATTAGATGACGATGAAGTTGAGGGTATATTGAAATATAA
TTAAATATTAATATATCAATCATATTATAATTAATTAAAAATAATAGAAAAATAAAATTA
AAGCTAGTAAAATTTAAAAAGAACCAGGAGCAGTAATAGTCTTTCTTCTAAAAATTAAGG
AATAGAAAATTCCTAGAATTTATAATAATAATACTGTTTAACTAATGACTACTCTTACTG
TTTCACACTATAAGATGCTCTTTTATTTAAAAACGATTTATGTAACTAACTAGATTTAAA
ATATGGAGATATTCAAAGCAGAATAATTGATATATAAAGAGATATAGTAAGAGAAATAGA
ACAATAAGTAAATTTTTTTTCTTTTATTTTGATTGATTAAATAAACTTAATTAAAATAAA
AGATTTTGTTATACAGTGAAGAAATAAATGCAGCTTAAGAATTTATAAGCGATCTAGATC
TTTTTTTTTGTTTGTATCAAGCTGCTGAAGTATATAATTTAAGAAAACCTAAACTTACAA
ATGATTCTTCATTAGTTTTTTAAGAAATGAGGAATATATTAACAGAAATAACAATAGGTG
AAAAATAATTTATTTCTAACAGTTTTTGTGTTCACAATTTTGCTCAATATATGAAGAACT
AAAAAATATAAACTAATAATTTTTTAGATTCCTAGTTTAGTAATAGATTTACATTTATAA
CAGGTCCTAATTATGCAGGCAAAAGTGTTTTCTTAAAAAGTGTAACTTATAATAAATATC
ACTTTACTTTTAATTGAAATTTATTCTTTAATTTTTACAATTAAGTTATTCATAAATTTT
AAGTTCCAAATAAATAAGTTATATAATTGCAATAAATGTTTACATATTTATAAAATTTAC
TATCCAATAGATCGGAATGATTACCTATCTTGCTCATATTGGTAGCTTTATTCCTTGCAG
ATTTGCCAGAATAGGAATGATAGATAATATTTTTGTAAATACTTGCTAACATGATTCAGT
TCTAAAATTCAATGGAGAGTCAGCATAGCAACTTTAATTCATAAACTACATTTTAAACTA
AGCTACTAATAGAACTTTAATACTCATAGATGAATTCGGAAAAAGTAATTTAATCAATAA
ACTGTATTTAAAACTTATTCTATTTTGTATAGATTTCAGGCTTAACGATAGTTTAAATTT
AAATTACTCCCTAGTTAAGTGCTTGACAGAAGATACATTCTAAGGTTTAAATGAAAAAAT
AACTTAAAAATAACATCCTTCTTTGTAATAAGAAGATAATGATTAAAACATTTTTTATTA
ATATTAAACTGATAATTCTTAAGTGGAAAATATTGATGAAATAAAATAGTAAAATTTGAG
AGGTTTGAATGAGTTTCAGTTTATACATTAAGACATTTAAAATGTTAATTTAATGGAACA
ATACAATAAAATTCCTATCACTCTGATGGCAAGCCACTTAAGTTAGCTTGTTAATTTGTG
TGGACTGAGAGAAAACTATATAATTAGATTTGCATAAATGGAAGTATTAATATAATAAGG
AAAAAATGTTTGCAAACTTAATGAATTAAAGGAGAATATTAATGCTATGCAGAAGATTGT
TCATGTATATAAACTAAATAAAGGTTTATCCTTAAAAAGTTGCTCCTCATTAGTTGCTAA
GAATATTTTCAGAGATAATGAATATCTTATTCATAGAATTAATGAAATAAATTAATTTAT
TTTAGAAGGAAAATTTTAAGTCTCGCCATAATAAAATGTTGAATAAATTCATCTTGAAAA
GGTTTAAAAAGTTATAAATATTTTAAATTCTTTGAAAGAGTAATAAATTTAATGAATTTA
TAAATTATTTTTTTGTTGAATATCCTTTTTTGTAATTGTTTTATTATTTCATTTTTTAAC
ACTATTATAAATATTATTTAATTAATTAAATAATATTAAATTTGTAGCTATAAATTTACC
AATA