Identifiers and Description

Gene Model Identifier

TTHERM_00857890

Standard Name

MSH4 (Homolog of budding yeast MSH4)

Aliases

PreTt09053 | 152.m00073

Description

MutS domain II family protein; Meiotic pro-crossover factor MutS domain II family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00857890

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_07185.14.9988663627895604e-120hypothetical protein (487 aa)
OxytrichaContig848.0.g754.0013320766793207e-25MutS domain V
Stentor CoeruleusSteCoe_109977.095474162284704e-23
WormBaseWBGene000018722.9990241513684e-21locus:him-14 MutS protein ho
molog him-14 status:Confirme
d UniProt:Q23405 protein_i
d:CCD73725.1
DictyBaseDDB_G02839573.0002687256732656e-20msh4 on chromosome: 4 position
1370478 to 1373603
SGDYFL003C3.9992896861436003e-19MSH4 Protein involved in meiot
ic recombination, required for
normal levels of crossing ove
r, colocalizes with Zip2p to d
iscrete foci on meiotic chromo
somes, has homology to bacteri
al MutS protein

General Information

Paragraph NoGene NameParagraph Text
97MSH4Msh4 (together with Msh5) is required for normal chiasma formation

Associated Literature

  1. Ref:28100637: Shodhan A, Kataoka K, Mochizuki K, Novatchkova M, Loidl J (2017) A Zip3-like protein plays a role in crossover formation in the SC-less meiosis of the protist Tetrahymena. Molecular biology of the cell 28(6):825-833
  2. Ref:25217051: Shodhan A, Lukaszewicz A, Novatchkova M, Loidl J (2014) Msh4 and Msh5 function in SC-independent chiasma formation during the streamlined meiosis of Tetrahymena. Genetics 198(3):983-93

Sequences

>TTHERM_00857890(coding)
ATGTTGAATAGAAAAAAAAATTTTAGAGCTCATTACAGTAATAAGAGCTCGTTTTCTAAT
ACAGATGACAAAGGTCTAGAAAAAAGTATTAACTAAGATTTCATAACTCCAAAAAATGGT
TTTGAATATCTAAAATTTAATATGAAAAAACATTAAAATTAAATTTAAAGTTTGGACAAT
TCATTTTAATCAATTTAACAAAAAAATTTAATACAAGAACTTCATTAGAATTTTTACAGC
TCTAATTAAGGTTAATTTCAATACATCACTCCTCTGTTAAAATAAAATGGAATAGATCAA
CACTTTAATCAAACCAACAATAATTATTAAACTAATTCCTCTAACTAAATGAATAGCTTA
TAGCAATAAAGTAATGAATAAATTCATTAAAATGGTTTTGATAGAGGTACTTTTCCTATA
AATAAATATTTTTAATTTTAAAATATAAGCTTTCCATTTATTAATGGTTAAAGTAGTAGT
GGTTTATTAAATTAGATTAATGATTCAAATTATATTATTGATAAAAGCTTTTCATCACTT
TAATAAACCAATAATCAGGATGTAATTAAAAGAAAGCTCTCAAACTTTGAAGAAATTACT
CCATAAATGATAGAAAATGCTTACAGTAATTCAAATAACTTTGATTCTGATTTAATAAAG
TTTTAAAATGAATTTCCAAGTTTGAATTAGAATAGCCTTTACTTTGATTAAAATATAAAT
ACTAAATGCTTAAATGACATTCATAATAACTAATTTTAAAATAAATTTTAAGAATCAAAT
TACTAAAAAGATTAAAAATTCTTCTTTAATTTTCCTTCATAATTGTGCGATAATTAATAT
GAAATTGACTAAAAAACCCTTGATTTTTAATAAAATTAAAATAATTATATATTTTTTAAA
TAAAAATAAGATTAATTAAATTAGGCCTTATTAGATTAATCATATAATAAGAATAAAGGC
CTTTATTTTTCATAAAATTTTAATAATAATTTTATTGGAGAAGAAAGTTTATCATAAAAA
TCTGATTAACTTGACTAATTCAATAAAGATTAATAGAATTACTTCGAAACTGATAACATT
TAGCAAGACTAAGATATATCATAAGTAAACTTTATAAATGATTAAATTGAGTGCAAAGTC
AATAGCTAACGTGATATATTTCAAATAAATTAAGACTCACAATAATAAAAAAATTTTAAT
TGTTTTATAGAGTAAGTAGGTTATCCAAATAATTAATTCAATTAAAACTTTAATGAAATT
AAATAAAATTTCTAAAATAACTAAATTTATAATTTAGAAAATGATGATTAAGATTAGTTA
GATGAATTCTAAAACTAAATTTAATAATAGTAAAACAACGAAGAAGTTTAAAATTAAAAT
AGAATAAAACATTAATGCATTAATTAAAATGAGTAGTTTTAAATCAATTAAATATCAATT
GATTCAGTTAAACCCTCTTAAAACAATCTTTTATTTAATTCAACTAAATCTTAAAAGTCT
TCTTCTAAAAAATAATCGCCTTACTAAAGCCTATCAGAGAATAAACTGAGCTTTTACATA
GATTCTATAAAATCACAATTTAAAGGAAAATAATTTTTCAACTCTCAGAAAAATAATAAT
GAAAAGTAAATTCAAGATAGCAATTTAAAAGATAATCAAAATAATTAATTTGATTATTAA
AAAGAAGAAGAATAAACTGAGCCAAAATAAAATATTTTTATAAGTAAAAAAGAATAGTTT
TTCAGTGAATAGTAAAATATTATTAAACACAAAAATATTGAAAAAAATAAGATCTTAGTA
TTTACTGATATAGCTCCAAAACCAGTAAAAGATACATCAAATTAATTTCAATCTCATAAA
GATCTAAAAAAGAATCATTTTTCTATAGCTGAAGAATAAGAAGAGTATGATGATGATGAT
AATGATAAAAATGATGATGGGGAAGAAGAACAAGAATAAGAAGAAGAAGAAAGCAAAGTT
TAGGATATTTTAAATTAACGAGATAAATAAAAAATGGAAGAATTTGATTCAATTTATAAT
GAGTTTAATAATGGTCTTAAATAAAAATTGTCAGACTAAATCAAGATAAATTAATTAAAC
TAAACAAATATGTTTGGACAAATTGATAATCATAATTATAAATAATAAGCTGAGTTGTAA
GAAAGTATCTTTAGTAGTAATAAATACTAAATAGATAAAAGATTAAACTCAAATCAAATG
CATAACTCAAAAGGCATGTAAAAAAATGATACGAAAATTAATTCAAATAAAACTCAACTC
TAATTATTTTCAAAGTAAGTGAAAAAAAGAAAAGAAATAAATTATTCTGAGGATAAGTTA
ATGTAAAAATAAATAACAGAACAATCTGAAATATATAGGTAACATATAGTTGCTATTATA
GAAAATCATGCTAACTAAGTTGGATTTGCTGCGTTCAATGTTCAAACAGGTTAAATTAGT
ATTAGTCAAATAGTTGATAGATTAACCTATTTAAATACAACATCTACAATTTTTGCTTTT
TATCCTCTTGAAATTATTTTTTCAAATACTCAGTCAAGTAGCTATTTAGTCAAAATTTTG
CAGCAACAACTACCTCTTACTAAATTTACTTCTGTAAAAAGAAACTACTTTGATGAAACC
AAAGGAGAATCTATCCTCAAAAAAAAAAGCTCAAATTTAATTTAGAAATTAGATAATCTT
TATGTTGCATTAGCATCTCTTAATGCATTAATTAACCATATAGAGGTAACTCAAGAGCTT
TATCTTTTAAAAGAATAACTTTAAATTGGGTTTATATAGATGGATAGCATTTTGGTTATG
GACCATAAAACGGCTTTGGATCTAGAATTATTAATTTAACAGTTGAGTTAAAATGAAAAA
GGTAGTCTCATTAGTCTATTTAAAATATAGACAGTGGCAGGCAAGAGATTGTTAAGATCA
AACTTATTGTAGCCGTTAAACGACCTTAAAAGTTTGTAAGATAGATAAAGTGCTGTATTT
GAATTTACAATGAATTAAGACTCTATTGTAACATTTTAGAATATTTTAAAGAATTTTAAA
GACTTTGAAACATCAACTGTGAAATTTATTCAAAAGATTAAATATTTAGAAACAAATAGA
ATAAGATAATATTTAATTCATATTTATAAAATATTTACGTTTCTTAAAAAGCTCTCATAG
TTATAATTGCAACTCTAAATAATAGATATGTAAAACAGCTACATAAAAGAATTAAAAAAC
CTTTTATGTGATTAATAACTTGAATAGATTAAAGAATCAATTAAATAAAATTTAGACTTA
TCCTATTTAGAAAAGATTTAAAATTAACAACAACATAAGTCTCATGATCTTATATATTTT
ATTCTTAAAGCAGAAAAGGATAATTTGTTGGAAATAGAAAGAACAAAAATGGTGAGCATT
TAAAAATATGCAAATGATATATTTTGTGAATATTAAAATAAGCTAATAGGATACGCTAGT
TTGGAGCTAAAAGAGAATGAAAATAGAGGTTACTATTTAATAGCTAGAAAGGCAAAAAAA
TAGAGTTAAAATATAAATTAAAAAAAAATAGAGGAGCTGATAGAAGATAATCTAATTGAG
GTAAATGATAATAAAATAGGTAAAAGTTCTCAAATAACTTTCGTGACTTAAATATTTGCA
GAGCTATCAAATCGTATAAAAGAAACAAAATATACTCTACTTTTATAGACGCAAAAAATA
ATCAAATAAATTATACCAATAATTCAAAATTCATTGGGTATTCTTTTTTAAATAAATTCT
TTAATTGCTCAGATAGATGTTTGTATATGTTTTGCAGATTTTTATTATTCATTTTCTTCT
GAAGAGACCCCTCTCTGCCTACCTAAACTGATTAATGAAGAGATAAACTTATTAGTACTT
GATGAATTTTATCATCCTCTACTAGTTTATAACAACAAAGACTAGTGGAGAAGAAAAAGT
TCAAATTAAAATTAACAAGATGAAAGTTTTGGACATTCAAATGTGTATATTTAAAAGAAT
AGCATTTGTATATCTGATTTAAATAATCTTCAACTATTTTTAGGTTAATAAAATTGTGGA
AAATCTATATTAATAAAAAGTATTGCGATTATTTAAATAATGGCACAAGTTGGGTGCTAT
GTTCCTGCTAAAAATGGAGTTATCTCACTAAAAAATTTGATTCTCTCTAAATTTTACACA
ACAGATAGCATCGAAGAGAAGTAAAGTTCATTTACTTCTGAGCTTTAATAACTCGACTTC
ATCATAAAATCGAAGGCTTCTAAGGATCAATAAAGAGGTTGCCTATCAGTTAATTAAGCA
CTTTCTCTATCAAAATCAAAGGATAAGACAATAATTCTAATAGATGAATTTTGCAGTAGC
AGTTAATACGAAGATAATATTTCAATAAGTCTTGCATTTTTAGAAGAAATATCAATATGC
TTTCCTAATAGTTTTTTGCTTTGTGCTTCAAAATACTATGAGCTAGTTCAAATGACTTAA
TTTTACAATAACTTTTAGTACTTTTTCATAAACTAAGACTATCAACTTAAAGAATTAAAT
GAAAATGATCAAGAGAATTAAATGATAGATTTTAGCGAAGCAAATAAAATTCTGTATGAA
TGTTTAAATCCTATCCTCTTGAAGTACATTATTACTAACTAGTTTGAAAATAGTTAAGCA
AATGATAATCAACTTCTAAAAACAGATTAATTGCATGTTTAAAATAAAACTCTAAACAAA
AAAATTATCAATGACATTGTTAAACAATTCGTGAGTAAGTATTGA


>TTHERM_00857890(protein)
MLNRKKNFRAHYSNKSSFSNTDDKGLEKSINQDFITPKNGFEYLKFNMKKHQNQIQSLDN
SFQSIQQKNLIQELHQNFYSSNQGQFQYITPLLKQNGIDQHFNQTNNNYQTNSSNQMNSL
QQQSNEQIHQNGFDRGTFPINKYFQFQNISFPFINGQSSSGLLNQINDSNYIIDKSFSSL
QQTNNQDVIKRKLSNFEEITPQMIENAYSNSNNFDSDLIKFQNEFPSLNQNSLYFDQNIN
TKCLNDIHNNQFQNKFQESNYQKDQKFFFNFPSQLCDNQYEIDQKTLDFQQNQNNYIFFK
QKQDQLNQALLDQSYNKNKGLYFSQNFNNNFIGEESLSQKSDQLDQFNKDQQNYFETDNI
QQDQDISQVNFINDQIECKVNSQRDIFQINQDSQQQKNFNCFIEQVGYPNNQFNQNFNEI
KQNFQNNQIYNLENDDQDQLDEFQNQIQQQQNNEEVQNQNRIKHQCINQNEQFQINQISI
DSVKPSQNNLLFNSTKSQKSSSKKQSPYQSLSENKLSFYIDSIKSQFKGKQFFNSQKNNN
EKQIQDSNLKDNQNNQFDYQKEEEQTEPKQNIFISKKEQFFSEQQNIIKHKNIEKNKILV
FTDIAPKPVKDTSNQFQSHKDLKKNHFSIAEEQEEYDDDDNDKNDDGEEEQEQEEEESKV
QDILNQRDKQKMEEFDSIYNEFNNGLKQKLSDQIKINQLNQTNMFGQIDNHNYKQQAELQ
ESIFSSNKYQIDKRLNSNQMHNSKGMQKNDTKINSNKTQLQLFSKQVKKRKEINYSEDKL
MQKQITEQSEIYRQHIVAIIENHANQVGFAAFNVQTGQISISQIVDRLTYLNTTSTIFAF
YPLEIIFSNTQSSSYLVKILQQQLPLTKFTSVKRNYFDETKGESILKKKSSNLIQKLDNL
YVALASLNALINHIEVTQELYLLKEQLQIGFIQMDSILVMDHKTALDLELLIQQLSQNEK
GSLISLFKIQTVAGKRLLRSNLLQPLNDLKSLQDRQSAVFEFTMNQDSIVTFQNILKNFK
DFETSTVKFIQKIKYLETNRIRQYLIHIYKIFTFLKKLSQLQLQLQIIDMQNSYIKELKN
LLCDQQLEQIKESIKQNLDLSYLEKIQNQQQHKSHDLIYFILKAEKDNLLEIERTKMVSI
QKYANDIFCEYQNKLIGYASLELKENENRGYYLIARKAKKQSQNINQKKIEELIEDNLIE
VNDNKIGKSSQITFVTQIFAELSNRIKETKYTLLLQTQKIIKQIIPIIQNSLGILFQINS
LIAQIDVCICFADFYYSFSSEETPLCLPKLINEEINLLVLDEFYHPLLVYNNKDQWRRKS
SNQNQQDESFGHSNVYIQKNSICISDLNNLQLFLGQQNCGKSILIKSIAIIQIMAQVGCY
VPAKNGVISLKNLILSKFYTTDSIEEKQSSFTSELQQLDFIIKSKASKDQQRGCLSVNQA
LSLSKSKDKTIILIDEFCSSSQYEDNISISLAFLEEISICFPNSFLLCASKYYELVQMTQ
FYNNFQYFFINQDYQLKELNENDQENQMIDFSEANKILYECLNPILLKYIITNQFENSQA
NDNQLLKTDQLHVQNKTLNKKIINDIVKQFVSKY


>TTHERM_00857890(gene)
ATGTTGAATAGAAAAAAAAATTTTAGAGCTCATTACAGTAATAAGAGCTCGTTTTCTAAT
ACAGATGACAAAGGTCTAGAAAAAAGTATTAACTAAGATTTCATAACTCCAAAAAATGGT
TTTGAATATCTAAAATTTAATATGAAAAAACATTAAAATTAAATTTAAAGTTTGGACAAT
TCATTTTAATCAATTTAACAAAAAAATTTAATACAAGAACTTCATTAGAATTTTTACAGC
TCTAATTAAGGTTAATTTCAATACATCACTCCTCTGTTAAAATAAAATGGAATAGATCAA
CACTTTAATCAAACCAACAATAATTATTAAACTAATTCCTCTAACTAAATGAATAGCTTA
TAGCAATAAAGTAATGAATAAATTCATTAAAATGGTTTTGATAGAGGTACTTTTCCTATA
AATAAATATTTTTAATTTTAAAATATAAGCTTTCCATTTATTAATGGTTAAAGTAGTAGT
GGTTTATTAAATTAGATTAATGATTCAAATTATATTATTGATAAAAGCTTTTCATCACTT
TAATAAACCAATAATCAGGATGTAATTAAAAGAAAGCTCTCAAACTTTGAAGAAATTACT
CCATAAATGATAGAAAATGCTTACAGTAATTCAAATAACTTTGATTCTGATTTAATAAAG
TTTTAAAATGAATTTCCAAGTTTGAATTAGAATAGCCTTTACTTTGATTAAAATATAAAT
ACTAAATGCTTAAATGACATTCATAATAACTAATTTTAAAATAAATTTTAAGAATCAAAT
TACTAAAAAGATTAAAAATTCTTCTTTAATTTTCCTTCATAATTGTGCGATAATTAATAT
GAAATTGACTAAAAAACCCTTGATTTTTAATAAAATTAAAATAATTATATATTTTTTAAA
TAAAAATAAGATTAATTAAATTAGGCCTTATTAGATTAATCATATAATAAGAATAAAGGC
CTTTATTTTTCATAAAATTTTAATAATAATTTTATTGGAGAAGAAAGTTTATCATAAAAA
TCTGATTAACTTGACTAATTCAATAAAGATTAATAGAATTACTTCGAAACTGATAACATT
TAGCAAGACTAAGATATATCATAAGTAAACTTTATAAATGATTAAATTGAGTGCAAAGTC
AATAGCTAACGTGATATATTTCAAATAAATTAAGACTCACAATAATAAAAAAATTTTAAT
TGTTTTATAGAGTAAGTAGGTTATCCAAATAATTAATTCAATTAAAACTTTAATGAAATT
AAATAAAATTTCTAAAATAACTAAATTTATAATTTAGAAAATGATGATTAAGATTAGTTA
GATGAATTCTAAAACTAAATTTAATAATAGTAAAACAACGAAGAAGTTTAAAATTAAAAT
AGAATAAAACATTAATGCATTAATTAAAATGAGTAGTTTTAAATCAATTAAATATCAATT
GATTCAGTTAAACCCTCTTAAAACAATCTTTTATTTAATTCAACTAAATCTTAAAAGTCT
TCTTCTAAAAAATAATCGCCTTACTAAAGCCTATCAGAGAATAAACTGAGCTTTTACATA
GATTCTATAAAATCACAATTTAAAGGAAAATAATTTTTCAACTCTCAGAAAAATAATAAT
GAAAAGTAAATTCAAGATAGCAATTTAAAAGATAATCAAAATAATTAATTTGATTATTAA
AAAGAAGAAGAATAAACTGAGCCAAAATAAAATATTTTTATAAGTAAAAAAGAATAGTTT
TTCAGTGAATAGTAAAATATTATTAAACACAAAAATATTGAAAAAAATAAGATCTTAGTA
TTTACTGATATAGCTCCAAAACCAGTAAAAGATACATCAAATTAATTTCAATCTCATAAA
GATCTAAAAAAGAATCATTTTTCTATAGCTGAAGAATAAGAAGAGTATGATGATGATGAT
AATGATAAAAATGATGATGGGGAAGAAGAACAAGAATAAGAAGAAGAAGAAAGCAAAGTT
TAGGATATTTTAAATTAACGAGATAAATAAAAAATGGAAGAATTTGATTCAATTTATAAT
GAGTTTAATAATGGTCTTAAATAAAAATTGTCAGACTAAATCAAGATAAATTAATTAAAC
TAAACAAATATGTTTGGACAAATTGATAATCATAATTATAAATAATAAGCTGAGTTGTAA
GAAAGTATCTTTAGTAGTAATAAATACTAAATAGATAAAAGATTAAACTCAAATCAAATG
CATAACTCAAAAGGCATGTAAAAAAATGATACGAAAATTAATTCAAATAAAACTCAACTC
TAATTATTTTCAAAGTAAGTGAAAAAAAGAAAAGAAATAAATTATTCTGAGGATAAGTTA
ATGTAAAAATAAATAACAGAACAATCTGAAATATATAGGTAACATATAGTTGCTATTATA
GAAAATCATGCTAACTAAGTTGGATTTGCTGCGTTCAATGTTCAAACAGGTTAAATTAGT
ATTAGTCAAATAGTTGATAGATTAACCTATTTAAATACAACATCTACAATTTTTGCTTTT
TATCCTCTTGAAATTATTTTTTCAAATACTCAGTCAAGTAGCTATTTAGTCAAAATTTTG
CAGCAACAACTACCTCTTACTAAATTTACTTCTGTAAAAAGAAACTACTTTGATGAAACC
AAAGGAGAATCTATCCTCAAAAAAAAAAGCTCAAATTTAATTTAGAAATTAGATAATCTT
TATGTTGCATTAGCATCTCTTAATGCATTAAGTAATACATTATTTTAATATTTAAATCTT
GATTTAACATTAAATGAAAATAAATTTTTATCAATCATTTAAATAAAAATTACATAAATT
TTTTAATTATAGTTAACCATATAGAGGTAACTCAAGAGCTTTATCTTTTAAAAGAATAAC
TTTAAATTGGGTTTATATAGATGGATAGCATTTTGGTTATGGACCATAAAACGGCTTTGG
ATCTAGAATTATTAATTTAACAGTTGAGTTAAAATGAAAAAGGTAGTCTCATTAGTCTAT
TTAAAATATAGACAGTGGCAGGCAAGAGATTGTTAAGATCAAACTTATTGTAGCCGTTAA
ACGACCTTAAAAGTTTGTAAGATAGATAAAGTGCTGTATTTGAATTTACAATGAATTAAG
ACTCTATTGTAACATTTTAGAATATTTTAAAGAATTTTAAAGACTTTGAAACATCAACTG
TGAAATTTATTCAAAAGATTAAATATTTAGAAACAAATAGAATAAGATAATATTTAATTC
ATATTTATAAAATATTTACGTTTCTTAAAAAGCTCTCATAGTTATAATTGCAACTCTAAA
TAATAGATATGTAAAACAGCTACATAAAAGAATTAAAAAACCTTTTATGTGATTAATAAC
TTGAATAGATTAAAGAATCAATTAAATAAAATTTAGACTTATCCTATTTAGAAAAGATTT
AAAATTAACAACAACATAAGTCTCATGATCTTGTAAATAAATATTTTATTTTTTAATAAT
TTAAAATTTTGATTTGAAAAAGTATATTTATTTTTATTATTTTAATAACTTTCAAAAATT
TCAAAATTACTAACTTATTTATTATATTTAAAAAATAAAAGTTAAAAAATTTATTTTTTT
ATTATTTAAAGTCTATTTAAAAAAAATATATATAATATTGATTTCAAAATAAAATCTTAA
TTTTATTAAAAACAATTTAAAAAATTTATTTAATAAAAATAGATATATTTTATTCTTAAA
GCAGAAAAGGATAATTTGTTGGAAATAGAAAGAACAAAAATGGTGAGCATTTAAAAATAT
GCAAATGATATATTTTGTGAATATTAAAATAAGCTAATAGGATACGCTAGTTTGGAGCTA
AAAGAGAATGAAAATAGAGGTTACTATTTAATAGCTAGAAAGGCAAAAAAATAGAGTTAA
AATATAAATTAAAAAAAAATAGAGGAGCTGATAGAAGATAATCTAATTGAGGTAAATGAT
AATAAAATAGGTAAAAGTTCTCAAATAACTTTCGTGACTTAAATATTTGCAGAGCTATCA
AATCGTATAAAAGAAACAAAATATACTCTACTTTTATAGACGCAAAAAATAATCAAATAA
ATTATACCAATAATTCAAAATTCATTGGGTATTCTTTTTTAAATAAATTCTTTAATTGCT
CAGATAGATGTTTGTATATGTTTTGCAGATTTTTATTATTCATTTTCTTCTGAAGAGACC
CCTCTCTGCCTACCTAAACTGATTAATGAAGAGATAAACTTATTAGTACTTGATGAATTT
TATCATCCTCTACTAGTTTATAACAACAAAGACTAGTGGAGAAGAAAAAGTTCAAATTAA
AATTAACAAGATGAAAGTTTTGGACATTCAAATGTGTATATTTAAAAGAATAGCATTTGT
ATATCTGATTTAAATAATCTTCAACTATTTTTAGGTTAATAAAATTGTGGAAAATCTATA
TTAATAAAAAGTATTGCGATTATTTAAATAATGGCACAAGTTGGGTGCTATGTTCCTGCT
AAAAATGGAGTTATCTCACTAAAAAATTTGATTCTCTCTAAATTTTACACAACAGATAGC
ATCGAAGAGAAGTAAAGTTCATTTACTTCTGAGCTTTAATAACTCGACTTCATCATAAAA
TCGAAGGCTTCTAAGGATCAATAAAGAGGTTGCCTATCAGTTAATTAAGCACTTTCTCTA
TCAAAATCAAAGTAAACTTGATTTTTTAATTAAATCTTATTAACCTAACAATAAAAATAA
GGGATAAGACAATAATTCTAATAGATGAATTTTGCAGTAGCAGTTAATACGAAGATAATA
TTTCAATAAGTCTTGCATTTTTAGAAGAAATATCAATATGCTTTCCTAATAGTTTTTTGC
TTTGTGCTTCAAAATACTATGAGCTAGTTCAAATGACTTAATTTTACAATAACTTTTAGT
ACTTTTTCATAAACTAAGACTATCAACTTAAAGAATTAAATGAAAATGATCAAGAGAATT
AAATGATAGATTTTAGCGAAGCAAATAAAATTCTGTATGAATGTTTAAATCCTATCCTCT
TGAAGTACATTATTACTAACTAGTTTGAAAATAGTTAAGCAAATGATAATCAACTTCTAA
AAACAGATTAATTGCATGTTTAAAATAAAACTCTAAACAAAAAAATTATCAATGACATTG
TTAAACAATTCGTGAGTAAGTATTGA