Identifiers and Description

Gene Model Identifier

TTHERM_00426230

Standard Name

MSH3 (homolog to human protein MSH3)

Aliases

PreTt14058 | 47.m00253

Description

MutS domain III family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00426230

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_00176.19.997093137033517e-262MutS domain III family protein
(2231 aa)
OxytrichaContig820.1.g1229.997093137033517e-262MutS domain V
DictyBaseDDB_G02686142.000319284850678e-127msh6 on chromosome: 1 position
238722 to 242663
SGDYDR097C9.997006461365152e-115MSH6 Protein required for mism
atch repair in mitosis and mei
osis, forms a complex with Msh
2p to repair both single-base
& insertion-deletion mispairs;
potentially phosphorylated by
Cdc28p
WormBaseWBGene000034221.9994050701445255e-104locus:msh-6 status:Partially
_confirmed UniProt:Q9N3T8
protein_id:CCD72556.1
Stentor CoeruleusSteCoe_175859.710436457780846e-67

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00426230(coding)
ATGCAAATCAACTTGAAAGCAAAAGAGTTTAGTACACTCGATGAAGATTCATCGTCAGAT
GATGATTAAGAATTCGTCAAAAGAATATTAGGATAAACTTCTAAAAATGAAAATAAATCA
GACATTAATACTAATCCGATTTAAAGCAATGCTCAAATAGGACAAAAATAGTAAAGCAAT
CTAAAATAAAATGTAGCTAATAGTTACGAAAATTAATTCAAGGGATTGAATGGGTTATAT
TAAAATAATTCACCTCAATAAAAGCTTCAGCCATAAGCTAAGACTTCATCAAATAATCTC
TCAGGAATCAACAAATCTTTATTAAATAAAAGTAAAAAGTCTACTTTAAATTAAAGTGAT
GATGAAGCTGAATAAATGAACATCGAAGAAGACTAAAATAGCGTTTAGACAAACCAAAAT
GATTTTTTAAACTAATTCTAGATGCAATCAAAACAAACTACTTTTAAGAACTCAACTTCA
AGATAAAGCAAATAGTATAGTGGAGATAATTAAAAAGGCAGCTTATCAATACCTAATAAA
GAGGAGGAATAGTTAAATTAAATCCCAAAATTTGCTTAACAAAGGTATCGTAAAGATTCC
AGATAAATTCCATTTGGGAATCCATAATATGACCCAACAACTTTGTATATTCCACCCTAA
GAATTTAGTAAACTCACAAGTGCGATGAAATAGTATTGGTAAATAAAAGCAAAGCATTTT
GACAAAATCATCTTATTCAAGATGGGAAAATTTTATGAACTCTTTTATGAAGATGCTATA
ATTGCAACTAGACTTTTAGATATCACTTTTACAAACAAAGAATTGCATTGTGGTTTCCCT
GAGAAGGCATTGGAAAAATTTGCTTCAAAGCTTGTTCAATTCGGATACAAAGTAGTTGTA
GTAGAGTAAACTTCTAAAAAGACGACTACAGGTATAGTAGACAGAGACATTACATAAATC
ATTACAAAAGGTACAATTAACTTCACTTTTGAAGAGTAAAATCACGATCCTAAGTATCTC
CTTGTTATCAGATAAAAAACAAACTAAGAGTTCGGTATAATTGTTTATGAATCTTTTACT
AGCAAAATTCAAGTCGGCCTACTGTAAGACGACAAAACATAGACAAGACTAAAATCATTT
TTATGTGTTACTAAACCTTAAGAAATAGTTTATGATCCAGGAAATATAACATCAGACATT
CTTAAAATATTGAAAAGTTAATATTTTTAGTCTGTTATGAGTCCCATGAGAGATAACAAA
GACTAATGGAGTACTCAGCTTGCAACCTTTTATATTGAGAAGCAATTTGGAAGCGAAGTG
CAAAAATACCCTCAAGAACTTAGAGATATTAGAACTAATGACGAAATTAGGGGCTAAGTT
ATTAATTTAAAATATGCTGCGCTTGCAGGATTTTTTTCATATATGGATTCTACTCTCCAG
TTAGAAAGTATTCTTAATTCCTCAGAATACGTTGAATGCGATTTCGATAATAAATAATTT
TCACAAAGAATGATCTTAGACAGCCAAGCACTTCAGCACTTAGAAATATTTGAAAACTCT
TAAACTGCTTTAACAACAACTTTTTAATAAGTTGACTAAAAGAAAGGAACACTTTTGAAT
TACCTTGACTACACTAAAACGCCATATGGTAAAAGAATGTTAAAAAAATGGGTTTGCTCT
CCATTGATTGACATTTCAGCTATAAATGATCGTTACGATGCTATTGAAGATATTTAAAAC
AATCTTGCGATGAAAGATAAGTTTTAATATGGAATAGCTAGATACGCAGATATTGAGCGT
CTTTGCTCTTCTATTTACAGATATAGCGTTAAATAAAAACATGCTGAGAAAGCTGTAATG
TATGAAAATATTTCCAGTGCAAGATTGAAAGAATTTAAAAATTTAATTAATTCAATGAAA
GAGATCGAAAAACTTATTGAAGAAACATTTATGGTTAACCAAGAAAATTTTAAGAGTTAA
AGACTCAAACGTTTATGTACTTATAGACTGAAAGGTGATCCAAAACTTTCTGGAGATTTA
CCTAAAGTCAGTAGCTTTATAAAAGTTCTTGAGGACATTATTGTCTTAGACTCTAAAGAA
AAAATAGCAGGAAAGTATATAGAATAACCAGTACCAAAGGATGGGTTTTGCTAAGAATAT
GATAGCATCAGACTTCAGATTAAAGCTTATTAAGATGAACTTGATTAATATTTAGAACAA
TTAAAAGTAAAATTCAAAACAAATGATATTTCATATGCATTTCTGAATAATAGATAATAT
GATATTTAAGTCAACAAAACTCTTTTTGATAAAATATAAAAACCTGCTGATTTCTCTCTA
TAAAGCCATTCTGGGTCGTTTCAGAGATTTACTAGCAGATTTACATCTGAAAAAGTTGCA
TTCATTGAGGAGTTGGAGGAATAACTTAAAGAAATTTTATCAAACTTCTGTGTAACTGTG
TTTAGAGAGTTCTATAAAAAGAAGCATGTTTGGGATAAATTTGTAAGTATAGTAGCTGAA
CTGGATTGCTTAATAAGCATAAGCCATGCTTGCTTTACAATGGCTGATGGTGTTATGTGC
AGACCTGTCATAAAGTTTGCAAAAAATTAAAAAGAAACCTTTTTCTATTTAAAATAAGGA
AGAAACCCTAATCTAATTTAATTGGATTTAAAATAAGTTCCAAATGATATCATTCTAGGA
AACATTGCAGGAATGAATGCTTAGCCTAATATTATGATTTTAACAGGTCCAAATATGGGT
GGTAAATCAACAACTTTAAGGTTGTTCTGTTTATCTGCTATTTTAGCTTAAATAGGTTGT
TATGTTCCTGCAGAGTAATGCGAATTTAGTTTAGTGGACAGAATTTTCACAAGAATTGGT
GCTGGTGATAAATTGATAGAAGGAAAAAGTACATTTTATATAGAAATGGAAGAAGTTAAA
AATTCAATTATGTATGGTACTTACAACAGTATTGCAATATTTGATGAATTAGGAAGAGGA
ACTTCCACATTTGATGGTGTAGCTATTGCTTTTGGAATTCTTAAATATTTTATTGAAAAA
ATTTAAAGTAGATGCATATTTGCTACCCATTTTTTCCTTTTGATAAATGAATTAAGATTT
TATAAAGAAATATCCTTTTATCATATGGAATACTATTACGATAACAAATCTAAAAAGCTC
ATATTTAAATACAAACTTAAATAAGGCAACGCAGAAAGCAGCTTTGGTATAGATTTAGCA
AAGATAGTCGGTATAGAATAATCTGTACTTAATTTAGCCTAAAAGAAGTAACTAGAATTC
GAAAACAGCTTAGAGTATGCAGAAGTAGAAAAGTAATAAACTATAAAATAGTTTAATGGG
CTCATTTCTAAGCTATTTACCTATGAAAAAGATAGAATATAATGA


>TTHERM_00426230(protein)
MQINLKAKEFSTLDEDSSSDDDQEFVKRILGQTSKNENKSDINTNPIQSNAQIGQKQQSN
LKQNVANSYENQFKGLNGLYQNNSPQQKLQPQAKTSSNNLSGINKSLLNKSKKSTLNQSD
DEAEQMNIEEDQNSVQTNQNDFLNQFQMQSKQTTFKNSTSRQSKQYSGDNQKGSLSIPNK
EEEQLNQIPKFAQQRYRKDSRQIPFGNPQYDPTTLYIPPQEFSKLTSAMKQYWQIKAKHF
DKIILFKMGKFYELFYEDAIIATRLLDITFTNKELHCGFPEKALEKFASKLVQFGYKVVV
VEQTSKKTTTGIVDRDITQIITKGTINFTFEEQNHDPKYLLVIRQKTNQEFGIIVYESFT
SKIQVGLLQDDKTQTRLKSFLCVTKPQEIVYDPGNITSDILKILKSQYFQSVMSPMRDNK
DQWSTQLATFYIEKQFGSEVQKYPQELRDIRTNDEIRGQVINLKYAALAGFFSYMDSTLQ
LESILNSSEYVECDFDNKQFSQRMILDSQALQHLEIFENSQTALTTTFQQVDQKKGTLLN
YLDYTKTPYGKRMLKKWVCSPLIDISAINDRYDAIEDIQNNLAMKDKFQYGIARYADIER
LCSSIYRYSVKQKHAEKAVMYENISSARLKEFKNLINSMKEIEKLIEETFMVNQENFKSQ
RLKRLCTYRLKGDPKLSGDLPKVSSFIKVLEDIIVLDSKEKIAGKYIEQPVPKDGFCQEY
DSIRLQIKAYQDELDQYLEQLKVKFKTNDISYAFLNNRQYDIQVNKTLFDKIQKPADFSL
QSHSGSFQRFTSRFTSEKVAFIEELEEQLKEILSNFCVTVFREFYKKKHVWDKFVSIVAE
LDCLISISHACFTMADGVMCRPVIKFAKNQKETFFYLKQGRNPNLIQLDLKQVPNDIILG
NIAGMNAQPNIMILTGPNMGGKSTTLRLFCLSAILAQIGCYVPAEQCEFSLVDRIFTRIG
AGDKLIEGKSTFYIEMEEVKNSIMYGTYNSIAIFDELGRGTSTFDGVAIAFGILKYFIEK
IQSRCIFATHFFLLINELRFYKEISFYHMEYYYDNKSKKLIFKYKLKQGNAESSFGIDLA
KIVGIEQSVLNLAQKKQLEFENSLEYAEVEKQQTIKQFNGLISKLFTYEKDRIQ


>TTHERM_00426230(gene)
ATGCAAATCAACTTGAAAGCAAAAGAGTTTAGTACACTCGATGAAGATTCATCGTCAGAT
GATGATTAAGAATTCGTCAAAAGAATATTAGGATAAACTTCTAAAAATGTAAGTTCATAC
TTAAAATTTAATGATAACGACATAATATTTTTGAGATTCGCAGCACATATTAGAATTAAA
TCTAAACTTTTATTGACTATTAGGAAAATAAATCAGACATTAATACTAATCCGATTTAAA
GCAATGCTCAAATAGGACAAAAATAGTAAAGCAATCTAAAATAAAATGTAGCTAATAGTT
ACGAAAATTAATTCAAGGGATTGAATGGGTTATATTAAAATAATTCACCTCAATAAAAGC
TTCAGCCATAAGCTAAGACTTCATCAAATAATCTCTCAGGAATCAACAAATCTTTATTAA
ATAAAAGTAAAAAGTCTACTTTAAATTAAAGTGATGATGAAGCTGAATAAATGAACATCG
AAGAAGACTAAAATAGCGTTTAGACAAACCAAAATGATTTTTTAAACTAATTCTAGATGC
AATCAAAACAAACTACTTTTAAGAACTCAACTTCAAGATAAAGCAAATAGTATAGTGGAG
ATAATTAAAAAGGCAGCTTATCAATACCTAATAAAGAGGAGGAATAGTTAAATTAAATCC
CAAAATTTGCTTAACAAAGGTATCGTAAAGATTCCAGATAAATTCCATTTGGGAATCCAT
AATATGACCCAACAACTTTGTATATTCCACCCTAAGAATTTAGTAAACTCACAAGTGCGA
TGAAATAGTATTGGTAAATAAAAGCAAAGCATTTTGACAAAATCATCTTATTCAAGATGG
GAAAATTTTATGAACTCTTTTATGAAGATGCTATAATTGCAACTAGACTTTTAGATATCA
CTTTTACAAACAAAGAATTGCATTGTGGTTTCCCTGAGAAGGCATTGGAAAAATTTGCTT
CAAAGCTTGTTCAATTCGGATACAAAGTAGTTGTAGTAGAGTAAACTTCTAAAAAGACGA
CTACAGGTATAGTAGACAGAGACATTACATAAATCATTACAAAAGGTACAATTAACTTCA
CTTTTGAAGAGTAAAATCACGATCCTAAGTATCTCCTTGTTATCAGGTAAGAAAAATATT
CATTTGATCAATTTTTTTTACTTACTACTGATCAAATCTTATCAAATTCTAAGCTTAATT
AAATGGCGCTTCAATTTATTTTTTCTCAAACAATTTGATAGATTAAATTTGAAATTATCA
AAAAAACAAATTAAGATTTTTAATTCTTATTCTAAATTATTAATTTAACAATCAACAAAA
ATAAAATTCTAAAGATGGCAATCGAAAATACTTTTATCGAATATATAACACATTAGATTT
TTTGTTTAGATTATAAAAATCTAAATTTTAGATTTCTGTCTCTATTTTTTATTATTTAAA
AACATTTTCCATAACTCTATTTTAAAAAATTGATGAGTTGACTTATTTTATAATCAGGCA
ATTAAACTTTATTTGATTTTTATGTTTATAAAAAGATGATAAATGATAAATTTTCAGAAT
AAGCTTATTTTAACAATACATTATTATTAGAAGTGACTTTTACTTACATTTTAATTTTTC
TAACAAAGCAAATCGTTTATTCGAGTATTTAAGTTTCGTTAATTTATACAGTAACTCGAT
TGATGATTGTGATATAGATTATTTATGTTTTTTATTTAAAAGCAAATAATTTCTATCTAT
TTTACAAATTTACTTAAAATAGATTAATCAATTTATTTATTGATTATCTGTTTCAACCTT
GTTTTAATTTTAATAGATAAAAAACAAACTAAGAGTTCGGTATAATTGTTTATGAATCTT
TTACTAGCAAAATTCAAGTCGGCCTACTGTAAGACGACAAAACATAGACAAGACTAAAAT
CATTTTTATGTGTTACTAAACCTTAAGAAATAGTTTATGATCCAGGAAATATAACATCAG
ACATTCTTAAAATATTGAAAAGTTAATATTTTTAGTCTGTTATGAGTCCCATGAGAGATA
ACAAAGACTAATGGAGTACTCAGCTTGCAACCTTTTATATTGAGAAGCAATTTGGAAGCG
AAGTGCAAAAATACCCTCAAGAACTTAGAGATATTAGAACTAATGACGAAATTAGGGGCT
AAGTTATTAATTTAAAATATGCTGCGCTTGCAGGATTTTTTTCATATATGGATTCTACTC
TCCAGTTAGAAAGTATTCTTAATTCCTCAGAATACGTTGAATGCGATTTCGATAATAAAT
AATTTTCACAAAGAATGATCTTAGACAGCCAAGCACTTCAGCACTTAGAAATATTTGAAA
ACTCTTAAACTGCTTTAACAACAACTTTTTAATAAGTTGACTAAAAGAAAGGAACACTTT
TGAATTACCTTGACTACACTAAAACGCCATATGGTAAAAGAATGTTAAAAAAATGGGTTT
GCTCTCCATTGATTGACATTTCAGCTATAAATGATCGTTACGATGCTATTGAAGATATTT
AAAACAATCTTGCGATGAAAGATAAGTTTTAATATGGAATAGCTAGATACGCAGATATTG
AGCGTCTTTGCTCTTCTATTTACAGGTATTTATCTATCTATATTTCTTTCTCTTCTTTAG
CAAATTTCCTTTTTTTATTTAATTTATTTTATAATTAATAACATGAAAGGGTTTTTATTT
GAGTTTGATTTATAATTGTTTATTTTTAATTAAAATTGAACAGATATAGCGTTAAATAAA
AACATGCTGAGAAAGCTGTAATGTATGAAAATATTTCCAGTGCAAGATTGAAAGAATTTA
AAAATTTAATTAATTCAATGAAAGAGATCGAAAAACTTATTGAAGAAACATTTATGGTTA
ACCAAGAAAATTTTAAGAGTTAAAGACTCAAACGTTTATGTACTTATAGACTGAAAGGTG
ATCCAAAACTTTCTGGAGATTTACCTAAAGTCAGTAGCTTTATAAAAGTTCTTGAGGACA
TTATTGTCTTAGACTCTAAAGAAAAAATAGCAGGAAAGTATATAGAATAACCAGTACCAA
AGGATGGGTTTTGCTAAGAATATGATAGCATCAGACTTCAGATTAAAGCTTATTAAGATG
AACTTGATTAATATTTAGAACAATTAAAAGTAAAATTCAAAACAAATGATATTTCATATG
CATTTCTGAATAATAGATAATATGATATTTAAGTCAACAAAACTCTTTTTGATAAAATAT
AAAAACCTGCTGATTTCTCTCTATAAAGCCATTCTGGGTCGTTTCAGAGATTTACTAGCA
GATTTACATCTGAAAAAGTTGCATTCATTGAGGAGTTGGAGGAATAACTTAAAGAAATTT
TATCAAACTTCTGTGTAACTGTGTTTAGAGAGTTCTATAAAAAGAAGCATGTTGGTTTTT
CATTTTTATTTAATTTTTTGCAATTATTTTTTTATTTTAAAATCAGTTAATTTTTTTTGG
AATAAATTAAAAAATTTCACTTTAGATTTTATTAAATTTTTCAGGTTTTTAGTTGAATTA
TTTATTTACTTAACAAAAATATTTTTTAATAATTTATTATTTTGAATTTTATTTTACTTA
AAAATAAAATAGGTTTGGGATAAATTTGTAAGTATAGTAGCTGAACTGGATTGCTTAATA
AGCATAAGCCATGCTTGCTTTACAATGGCTGATGGTGTTATGTGCAGACCTGTCATAAAG
TTTGCAAAAAATTAAAAAGAAACCTTTTTCTATTTAAAATAAGGAAGAAACCCTAATCTA
ATTTAATTGGATTTAAAATAAGTTCCAAATGATATCATTCTAGGAAACATTGCAGGAATG
AATGCTTAGCCTAATATTATGATTTTAACAGGTCCAAATATGGGTGGTAAATCAACAACT
TTAAGGTTGTTCTGTTTATCTGCTATTTTAGCTTAAATAGGTATTTATTTTAGAAATTAT
TAAAATTTTAAACTGATTCTTTAATTGAAACAAGGTTGTTATGTTCCTGCAGAGTAATGC
GAATTTAGTTTAGTGGACAGAATTTTCACAAGAATTGGTGCTGGTGATAAATTGATAGAA
GGAAAAAGTACATTTTATATAGAAATGGAAGAAGTTAAAAATTCAATTATGTATGGTACT
TACAACAGTATTGCAATATTTGATGAATTAGGAAGAGGAACTTCCACATTTGATGGTGTA
GCTATTGCTTTTGGAATTCTTAAATATTTTATTGAAAAAATTTAAAGTAGATGCATATTT
GCTACCCATTTTTTCCTTTTGATAAATGAATTAAGATTTTATAAAGAAATATCCTTTTAT
CATATGGAATACTATTACGATAACAAATCTAAAAAGCTCATATTTAAATACAAACTTAAA
TAAGGCAACGCAGAAAGCAGCTTTGGTATAGATTTAGCAAAGGTAAATTAAATTTATATC
TTTATTTAAAATATGTGAAAATTAAAAAAAAATATTTTAGATAGTCGGTATAGAATAATC
TGTACTTAATTTAGCCTAAAAGAAGTAACTAGAATTCGAAAACAGCTTAGAGTATGCAGA
AGTAGAAAAGTAATAAACTATAAAATAGTTTAATGGGCTCATTTCTAAGCTATTTACCTA
TGAAAAAGATAGAATATAATGA