Identifiers and Description

Gene Model Identifier

TTHERM_00295920

Standard Name

MSH2 (mismatch repair gene )

Aliases

PreTt15702 | 27.m00362 | 3692.m00165

Description

MutS domain III family protein; homolog to human MSH2

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00488 ) MutS domain V
  • ( PF05188 ) MutS domain II
  • ( PF05192 ) MutS domain III
  • ( PF05190 ) MutS family domain IV
  • ( TIGR01069 ) MutS2 family protein
  • ( TIGR01070 ) DNA mismatch repair protein MutS
  • ( PF03904 ) Domain of unknown function (DUF334)
  • ( PF08011 ) Protein of unknown function (DUF1703)
  • ( PF08385 ) Dynein heavy chain, N-terminal region

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 15.3%

TetraMine Data

TTHERM_00295920

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_08853.19.997093137033517e-262MutS domain III family protein
(815 aa)
OxytrichaContig22029.0.g679.997093137033517e-262MutS domain V
SGDYOL090W8.995855300591991e-150MSH2 Protein that forms hetero
dimers with Msh3p and Msh6p th
at bind to DNA mismatches to i
nitiate the mismatch repair pr
ocess; contains a Walker ATP-b
inding motif required for repa
ir activity; Msh2p-Msh6p binds
to and hydrolyzes ATP
DictyBaseDDB_G02758097.000020090806431e-140msh2 on chromosome: 2 position
5513128 to 5516287
WormBaseWBGene000034181.0000732791548452e-89locus:msh-2 status:Confirmed
UniProt:Q9TXR4 protein_id
:CCD68358.1
Stentor CoeruleusSteCoe_342711.368539471173853e-44

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00295920(coding)
ATGGAAGAGGAAATTGAATTAGTTAATGATAAGAACTTGATGGTTCTTGCTGTTTATTTT
ACTTACCCAAACAATACTCGTTAAGTAAATGCTGCTATTTTAGACAGTGATTAAAGAAAA
TTCTAAGTTACAGAATTCTAAGACACAGAATATTACTCAAATTTTGAGTCCCTCATTCTC
TAGACCAACCCTTAAAATTAGCATACCCAATTTTTGTTGTTAATCCAGTATCCAGATTTG
ACAACAGAAAAAGAAAAAGTCAATGATATTGTTTAACAATGCGACATTAATGTGAAAGAA
AAGGATAAGAAAAGTTTTTTAGAAAAGGGTTATGAAGATGACCTTAATAAATTATTAAAA
AAACCTTTAGCCTAATATATTTAAGAAAGTTAACTTACTCATGCTTTGAGTAGTTTGGCT
TGTATTGTAGGTGATTTATAACTGTCTAAAGAACCTACTAATTAAAATTAATTCACTGTT
GAGACATTGATCTTGAATAATTTTATGAAATTGGATCTCGCTGCTATTAATGCCCTTTTA
ATTTTCCCAAAAGAAAAAGATATCTAGAGAAGAAACTTAATGGGTGGTCAAGAAAATAAT
TTTAGTACATTAGTTGACTTATTAGACAAGTGCAAAACTCAAATTGGCAGTAGAACCTTA
AAGCGCTGGATAAAGCAACCTCTTAAAAATGAGGCTGAAATCAATAGAAGACTTGATATT
GTTGAATATTTTGTCAACAATTAAGATTTGAGAAACTACATTCAAAATGAATTTTTAAGA
AAAATAGCTGACTTAGATAAGCTATATGCTAAATTCTATAAAGTCGCTAGTAAGAAAAAG
CATAACGCTAGTTTAGCTGATTGTATCAAAGTCTATCAACTTGTTACTAATCTAAGTACT
TTAGCACAATATATTGAAAATAACCACTCAGCTGATGAATTAGCATAGAGGGAATTTTTA
ATACCTTTAGGGGAAATACTTGAAAATTTTGAAAAGCTTTCTAGTATGATTGATTAATCA
ATAGATATGGAAAAGGCGAGACGTGATAATGAATACTAAGTTAGTTCTAAATTCTCTCCA
ACTTTAGCAGAACTTGCAAAACAAATGAAATAAATCATGAAGTAAATTGAATCATTAAGA
AATGAATATGCATAAGAATTAGGAGTTGAGCCTAAATTAGTGGAATCTACTACTCACACT
TATTTGTTTGAAAGTAAAAAGAAAGAGACAGATGAAGCCTTCCGTCGTCTCCATAGTCGT
AAGTATAAATCTATTTCAGTTAAGAAAGGCTGTATTTCCTTTACAACTGATGAATTATAA
GCTTGTGTAGCTGAGTATAACAGCTTAAAAGATAACTATTAAGAAGAGTAGAAGTCTGTA
GTTTAGAAAATATTAGACGTCGTTTCTACATACTACCCTGCTATGGAACGTGCAAGTTTC
GTTATTTCTGAATTGGATGTTCTTGCTAACTTTGCTTCTTTAGTTAACTCAGCCACTCGT
CCATATGTCAAACCCAATATTCATGCATCAAATAAGCAAATTAACTTAGTAGAATCTCGT
CATCCCTGCTTAGAAGTAATGGACAATAATTGTGTAGCAAATGACTGCTTTATGGATAAT
GACAAGTCTCGTTTCCATATCATTACTGGGCCAAATATGGGTGGTAAAAGTACTTTTATT
AGATAAGTTGCCATATGCGTTCTATTAGCTCATATTGGTTGCTTTATACCCTGCAAGAGT
GGTGAAATGCCTATCATTGATGCAATCATTACAAGAGTAGGTGCAAGTGATATGCAACTT
CGTGGTATTAGTACTTTCATGAGTGAAATGTTAGAAGCTTCTAACATGTTAATGACAGCA
ACTGAAAATTCTTTAATTATAATCGATGAACTTGGTCGTGGTACTTCTACAAGTGAAGGA
TTTGGTATCGCATGGGCTATTTCAGAACATATTGCTAATAAAATCAAATGTTATTGCTTA
TTTGCAACTCATTTCCATGAAATGACCAAAATGGAACAAGAAGTTAAAGGAGTAATTAAC
TATTATGTAAGCTGTGTAACAATAGACAATAAATTGACTATGCAATATAAATTAAAGAGA
GGTTTTGCTGAGCGTAGTTATGGTTTGTTTGTTGCAGAAACTTTAGATTTCCCTAGAGAA
ATTCTTGAGCATGCCTCAAATAAGCTTTTAGAACTGGAAAGTTATTCAAAGGGAATTTCT
GAAAACCAGAGCTCGGATTAAAATTTTGAGAATTTCAATAAAAATAGCTAAACAGACGAC
ATATTTTTACTTAGTAAGAACTCAACAATTGCTCAAAAAGAAGCTGTTGTTGATCTTGCT
TCTTCCTATAATGAAAAAATAAGAAATGCTGCTTCTAAAGAATAAAAGAAGTAACTACTT
AATGAATTAAAATAAAAAATTATTTCTGCTTTAAAATCTTGA


>TTHERM_00295920(protein)
MEEEIELVNDKNLMVLAVYFTYPNNTRQVNAAILDSDQRKFQVTEFQDTEYYSNFESLIL
QTNPQNQHTQFLLLIQYPDLTTEKEKVNDIVQQCDINVKEKDKKSFLEKGYEDDLNKLLK
KPLAQYIQESQLTHALSSLACIVGDLQLSKEPTNQNQFTVETLILNNFMKLDLAAINALL
IFPKEKDIQRRNLMGGQENNFSTLVDLLDKCKTQIGSRTLKRWIKQPLKNEAEINRRLDI
VEYFVNNQDLRNYIQNEFLRKIADLDKLYAKFYKVASKKKHNASLADCIKVYQLVTNLST
LAQYIENNHSADELAQREFLIPLGEILENFEKLSSMIDQSIDMEKARRDNEYQVSSKFSP
TLAELAKQMKQIMKQIESLRNEYAQELGVEPKLVESTTHTYLFESKKKETDEAFRRLHSR
KYKSISVKKGCISFTTDELQACVAEYNSLKDNYQEEQKSVVQKILDVVSTYYPAMERASF
VISELDVLANFASLVNSATRPYVKPNIHASNKQINLVESRHPCLEVMDNNCVANDCFMDN
DKSRFHIITGPNMGGKSTFIRQVAICVLLAHIGCFIPCKSGEMPIIDAIITRVGASDMQL
RGISTFMSEMLEASNMLMTATENSLIIIDELGRGTSTSEGFGIAWAISEHIANKIKCYCL
FATHFHEMTKMEQEVKGVINYYVSCVTIDNKLTMQYKLKRGFAERSYGLFVAETLDFPRE
ILEHASNKLLELESYSKGISENQSSDQNFENFNKNSQTDDIFLLSKNSTIAQKEAVVDLA
SSYNEKIRNAASKEQKKQLLNELKQKIISALKS


>TTHERM_00295920(gene)
ATGGAAGAGGAAATTGAATTAGTTAATGATAAGAACTTGATGGTTCTTGCTGTTTATTTT
ACTTACCCAAACAATACTCGTTAAGTAAATGCTGCTATTTTAGACAGTGATTAAAGAAAA
TTCTAAGTTACAGAATTCTAAGACACAGAATATTACTCAAATTTTGAGTCCCTCATTCTC
TAGACCAACCCTTAAAATTAGCATACCCAATTTTTGTTGTTAATCCAGTATCCAGATTTG
ACAACAGAAAAAGAAAAAGTCAATGATATTGTTTAACAATGCGACATTAATGTGAAAGAA
AAGTAATTTTTATTGAATAAAATTGAAATTTCATTTTAAAAATCTTATTTAAATGTAAAA
ATTATAGGGATAAGAAAAGTTTTTTAGAAAAGGGTTATGAAGATGACCTTAATAAATTAT
TAAAAAAACCTTTAGCCTAATATATTTAAGAAAGTTAACTTACTCATGCTTTGAGTAGTT
TGGCTTGTATTGTAGGTGATTTATAACTGTCTAAAGAACCTACTAATTAAAATTAATTCA
CTGTTGAGACATTGATCTTGAATAATTTTATGAAATTGGATCTCGCTGCTATTAATGCCC
TTTTAATTTTCCCAAAAGAAAAAGATATCTAGAGAAGAAACTTAATGGGTGGTCAAGAAA
ATAATTTTAGTACATTAGTTGACTTATTAGACAAGTGCAAAACTCAAATTGGCAGTAGAA
CCTTAAAGCGCTGGATAAAGCAACCTCTTAAAAATGAGGCTGAAATCAATAGAAGACTTG
ATATTGTTGAATATTTTGTCAACAATTAAGATTTGAGAAACTACATTCAAAATGAATTTT
TAAGAAAAATAGCTGACTTAGATAAGCTATATGCTAAATTCTATAAAGTCGCTAGTAAGA
AAAAGCATAACGCTAGTTTAGCTGATTGTATCAAAGTCTATCAACTTGTTACTAATCTAA
GTACTTTAGCACAATATATTGAAAATAACCACTCGTAAATTCTATTTGCATGTTATTAAT
AATATTTTATTGATTAAATTATAAAAAAAAAGAGCTGATGAATTAGCATAGAGGGAATTT
TTAATACCTTTAGGGGAAATACTTGAAAATTTTGAAAAGCTTTCTAGTATGATTGATTAA
TCAATAGATATGGAAAAGGCGAGACGTGATAATGAATACTAAGTTAGTTCTAAATTCTCT
CCAACTTTAGCAGAACTTGCAAAACAAATGAAATAAATCATGAAGTAAATTGAATCATTA
AGAAATGAATATGCATAAGAATTAGGAGTTGAGCCTAAATTAGTGGAATCTACTACTCAC
ACTTATTTGTTTGAAAGTAAAAAGAAAGAGACAGATGAAGCCTTCCGTCGTCTCCATAGT
CGTAAGTATAAATCTATTTCAGTTAAGAAAGGCTGTATTTCCTTTACAACTGATGAATTA
TAAGCTTGTGTAGCTGAGTATAACAGCTTAAAAGATAACTATTAAGAAGAGTAGAAGTCT
GTAGTTTAGAAAATATTAGACGTCGTTTCTACATACTACCCTGCTATGGAACGTGCAAGT
TTCGTTATTTCTGAATTGGATGTTCTTGCTAACTTTGCTTCTTTAGTTAACTCAGCCACT
CGTCCATATGTCAAACCCAATATTCATGCATCAAATAAGCAAATTAACTTAGTAGAATCT
CGTCATCCCTGCTTAGAAGTAATGGACAATAATTGTGTAGCAAATGACTGCTTTATGGAT
AATGACAAGTCTCGTTTCCATATCATTACTGGGCCAAATATGGGTGGTAAAAGTACTTTT
ATTAGATAAGTTGCCATATGCGTTCTATTAGCTCATATTGGTTGCTTTATACCCTGCAAG
AGTGGTGAAATGCCTATCATTGATGCAATCATTACAAGAGTAGGTGCAAGTGATATGCAA
CTTCGTGGTATTAGTACTTTCATGAGTGAAATGTTAGAAGCTTCTAACATGTTAATGACA
GCAACTGAAAATTCTTTAATTATAATCGATGAACTTGGTCGTGGTACTTCTACAAGTGAA
GGATTTGGTATCGCATGGGCTATTTCAGGTAATTTAAAACCTTATTATAAATTAATTTAT
TATAATTATAATTATTTAATTACTAGAACATATTGCTAATAAAATCAAATGTTATTGCTT
ATTTGCAACTCATTTCCATGAAATGACCAAAATGGAACAAGAAGTTAAAGGAGTAATTAA
CTATTATGTAAGCTGTGTAACAATAGACAATAAATTGACTATGCAATATAAATTAAAGAG
AGGTTTTGCTGAGCGTAGTTATGGTTTGTTTGTTGCAGAAACTTTAGATTTCCCTAGAGA
AATTCTTGAGCATGCCTCAAATAAGCTTTTAGAACTGGAAAGTTATTCAAAGGGAATTTC
TGAAAACCAGAGCTCGGATTAAAATTTTGAGAATTTCAATAAAAATAGCTAAACAGACGA
CATATTTTTACTTAGTAAGAACTCAACAATTGCTCAAAAAGAAGCTGTTGTTGATCTTGC
TTCTTCCTATAATGAAAAAATAAGAAATGCTGCTTCTAAAGAATAAAAGAAGTAACTACT
TAATGAATTAAAATAAAAAATTATTTCTGCTTTAAAATCTTGA